BLASTX nr result
ID: Cinnamomum25_contig00003741
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00003741 (378 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010264801.1| PREDICTED: exosome complex component CSL4 [N... 60 7e-07 ref|XP_010102192.1| hypothetical protein L484_024473 [Morus nota... 56 8e-06 >ref|XP_010264801.1| PREDICTED: exosome complex component CSL4 [Nelumbo nucifera] Length = 198 Score = 59.7 bits (143), Expect = 7e-07 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = +1 Query: 214 MVTPGEVLGKASPLLTAGSGAYVNPHNQIIYASITGRRHVIHP 342 MVTPGEVLGKAS + AG GAY+ PHN+ +YAS+TGRR VI P Sbjct: 10 MVTPGEVLGKASDV-KAGRGAYLAPHNKTVYASLTGRRIVIPP 51 >ref|XP_010102192.1| hypothetical protein L484_024473 [Morus notabilis] gi|587904939|gb|EXB93135.1| hypothetical protein L484_024473 [Morus notabilis] Length = 173 Score = 56.2 bits (134), Expect = 8e-06 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = +1 Query: 211 LMVTPGEVLGKASPLLTAGSGAYVNPHNQIIYASITGRRHVIHPP 345 ++VTPGEVLGK+S L AG+GAYV+P + +YAS+TG R ++ PP Sbjct: 7 VVVTPGEVLGKSSDL-KAGAGAYVSPQDHAVYASLTGFRRILSPP 50