BLASTX nr result
ID: Cinnamomum25_contig00003316
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00003316 (238 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010275284.1| PREDICTED: microfibrillar-associated protein... 61 3e-07 ref|XP_010260413.1| PREDICTED: microfibrillar-associated protein... 61 3e-07 ref|XP_009336432.1| PREDICTED: microfibrillar-associated protein... 61 3e-07 emb|CDP19850.1| unnamed protein product [Coffea canephora] 61 3e-07 ref|XP_008442034.1| PREDICTED: microfibrillar-associated protein... 61 3e-07 ref|XP_008361533.1| PREDICTED: microfibrillar-associated protein... 61 3e-07 ref|XP_008386054.1| PREDICTED: microfibrillar-associated protein... 61 3e-07 ref|XP_008227035.1| PREDICTED: microfibrillar-associated protein... 61 3e-07 ref|XP_004300097.1| PREDICTED: microfibrillar-associated protein... 61 3e-07 ref|XP_007211722.1| hypothetical protein PRUPE_ppa005985mg [Prun... 61 3e-07 ref|XP_011653945.1| PREDICTED: microfibrillar-associated protein... 61 3e-07 emb|CBI17794.3| unnamed protein product [Vitis vinifera] 60 6e-07 ref|XP_002275399.1| PREDICTED: microfibrillar-associated protein... 60 6e-07 emb|CAN78798.1| hypothetical protein VITISV_035471 [Vitis vinifera] 60 6e-07 ref|XP_010056419.1| PREDICTED: microfibrillar-associated protein... 60 7e-07 ref|XP_010034022.1| PREDICTED: microfibrillar-associated protein... 60 7e-07 ref|XP_008231592.1| PREDICTED: microfibrillar-associated protein... 59 1e-06 ref|XP_007211724.1| hypothetical protein PRUPE_ppa006012mg [Prun... 59 1e-06 ref|XP_010094194.1| hypothetical protein L484_016737 [Morus nota... 59 1e-06 ref|XP_008799939.1| PREDICTED: microfibrillar-associated protein... 59 1e-06 >ref|XP_010275284.1| PREDICTED: microfibrillar-associated protein 1-like [Nelumbo nucifera] Length = 434 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -3 Query: 236 PRLRRLAESKIDNKEAVRADHRRVRQAEIVSTI 138 PRLRRLAES+IDN+E +RADHRR+RQAEIVSTI Sbjct: 75 PRLRRLAESRIDNREEIRADHRRIRQAEIVSTI 107 >ref|XP_010260413.1| PREDICTED: microfibrillar-associated protein 1-like [Nelumbo nucifera] gi|720014179|ref|XP_010260414.1| PREDICTED: microfibrillar-associated protein 1-like [Nelumbo nucifera] Length = 428 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -3 Query: 236 PRLRRLAESKIDNKEAVRADHRRVRQAEIVSTI 138 PRLRRLAES+IDN+E +RADHRR+RQAEIVSTI Sbjct: 75 PRLRRLAESRIDNREEIRADHRRIRQAEIVSTI 107 >ref|XP_009336432.1| PREDICTED: microfibrillar-associated protein 1-like [Pyrus x bretschneideri] gi|694416622|ref|XP_009336433.1| PREDICTED: microfibrillar-associated protein 1-like [Pyrus x bretschneideri] Length = 428 Score = 60.8 bits (146), Expect = 3e-07 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -3 Query: 236 PRLRRLAESKIDNKEAVRADHRRVRQAEIVSTI 138 PRLRRLAES+IDN+E VRADHRR+RQAEIVSTI Sbjct: 69 PRLRRLAESRIDNREDVRADHRRIRQAEIVSTI 101 >emb|CDP19850.1| unnamed protein product [Coffea canephora] Length = 436 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -3 Query: 236 PRLRRLAESKIDNKEAVRADHRRVRQAEIVSTI 138 PRLRRLAES+IDN+E +RADHRR+RQAEIVSTI Sbjct: 75 PRLRRLAESRIDNREEIRADHRRIRQAEIVSTI 107 >ref|XP_008442034.1| PREDICTED: microfibrillar-associated protein 1 [Cucumis melo] gi|659082795|ref|XP_008442035.1| PREDICTED: microfibrillar-associated protein 1 [Cucumis melo] Length = 433 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -3 Query: 236 PRLRRLAESKIDNKEAVRADHRRVRQAEIVSTI 138 PRLRRLAES+IDN+E +RADHRR+RQAEIVSTI Sbjct: 74 PRLRRLAESRIDNREEIRADHRRIRQAEIVSTI 106 >ref|XP_008361533.1| PREDICTED: microfibrillar-associated protein 1-like [Malus domestica] Length = 428 Score = 60.8 bits (146), Expect = 3e-07 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -3 Query: 236 PRLRRLAESKIDNKEAVRADHRRVRQAEIVSTI 138 PRLRRLAES+IDN+E VRADHRR+RQAEIVSTI Sbjct: 69 PRLRRLAESRIDNREDVRADHRRIRQAEIVSTI 101 >ref|XP_008386054.1| PREDICTED: microfibrillar-associated protein 1-like [Malus domestica] gi|657987786|ref|XP_008386055.1| PREDICTED: microfibrillar-associated protein 1-like [Malus domestica] gi|657987788|ref|XP_008386056.1| PREDICTED: microfibrillar-associated protein 1-like [Malus domestica] Length = 389 Score = 60.8 bits (146), Expect = 3e-07 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -3 Query: 236 PRLRRLAESKIDNKEAVRADHRRVRQAEIVSTI 138 PRLRRLAES+IDN+E VRADHRR+RQAEIVSTI Sbjct: 69 PRLRRLAESRIDNREDVRADHRRIRQAEIVSTI 101 >ref|XP_008227035.1| PREDICTED: microfibrillar-associated protein 1-like [Prunus mume] Length = 433 Score = 60.8 bits (146), Expect = 3e-07 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -3 Query: 236 PRLRRLAESKIDNKEAVRADHRRVRQAEIVSTI 138 PRLRRLAES+IDN+E VRADHRR+RQAEIVSTI Sbjct: 74 PRLRRLAESRIDNREDVRADHRRIRQAEIVSTI 106 >ref|XP_004300097.1| PREDICTED: microfibrillar-associated protein 1-like [Fragaria vesca subsp. vesca] Length = 434 Score = 60.8 bits (146), Expect = 3e-07 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -3 Query: 236 PRLRRLAESKIDNKEAVRADHRRVRQAEIVSTI 138 PRLRRLAES+IDN+E VRADHRR+RQAEIVSTI Sbjct: 74 PRLRRLAESRIDNREDVRADHRRIRQAEIVSTI 106 >ref|XP_007211722.1| hypothetical protein PRUPE_ppa005985mg [Prunus persica] gi|462407587|gb|EMJ12921.1| hypothetical protein PRUPE_ppa005985mg [Prunus persica] Length = 433 Score = 60.8 bits (146), Expect = 3e-07 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -3 Query: 236 PRLRRLAESKIDNKEAVRADHRRVRQAEIVSTI 138 PRLRRLAES+IDN+E VRADHRR+RQAEIVSTI Sbjct: 74 PRLRRLAESRIDNREDVRADHRRIRQAEIVSTI 106 >ref|XP_011653945.1| PREDICTED: microfibrillar-associated protein 1 [Cucumis sativus] gi|700199741|gb|KGN54899.1| hypothetical protein Csa_4G578870 [Cucumis sativus] Length = 433 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -3 Query: 236 PRLRRLAESKIDNKEAVRADHRRVRQAEIVSTI 138 PRLRRLAES+IDN+E +RADHRR+RQAEIVSTI Sbjct: 74 PRLRRLAESRIDNREEIRADHRRIRQAEIVSTI 106 >emb|CBI17794.3| unnamed protein product [Vitis vinifera] Length = 345 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -3 Query: 236 PRLRRLAESKIDNKEAVRADHRRVRQAEIVSTI 138 PRLRRLAES+IDN++ VRADHRR+RQAEIVSTI Sbjct: 77 PRLRRLAESRIDNRDEVRADHRRIRQAEIVSTI 109 >ref|XP_002275399.1| PREDICTED: microfibrillar-associated protein 1-like [Vitis vinifera] Length = 436 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -3 Query: 236 PRLRRLAESKIDNKEAVRADHRRVRQAEIVSTI 138 PRLRRLAES+IDN++ VRADHRR+RQAEIVSTI Sbjct: 77 PRLRRLAESRIDNRDEVRADHRRIRQAEIVSTI 109 >emb|CAN78798.1| hypothetical protein VITISV_035471 [Vitis vinifera] Length = 414 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -3 Query: 236 PRLRRLAESKIDNKEAVRADHRRVRQAEIVSTI 138 PRLRRLAES+IDN++ VRADHRR+RQAEIVSTI Sbjct: 77 PRLRRLAESRIDNRDEVRADHRRIRQAEIVSTI 109 >ref|XP_010056419.1| PREDICTED: microfibrillar-associated protein 1-like [Eucalyptus grandis] gi|702341390|ref|XP_010056421.1| PREDICTED: microfibrillar-associated protein 1-like [Eucalyptus grandis] gi|629107998|gb|KCW73144.1| hypothetical protein EUGRSUZ_E01598 [Eucalyptus grandis] Length = 433 Score = 59.7 bits (143), Expect = 7e-07 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -3 Query: 236 PRLRRLAESKIDNKEAVRADHRRVRQAEIVSTI 138 PRLRRLAES+IDN++ +RADHRR+RQAEIVSTI Sbjct: 74 PRLRRLAESRIDNRDEIRADHRRIRQAEIVSTI 106 >ref|XP_010034022.1| PREDICTED: microfibrillar-associated protein 1-like [Eucalyptus grandis] gi|702484621|ref|XP_010034023.1| PREDICTED: microfibrillar-associated protein 1-like [Eucalyptus grandis] gi|702484625|ref|XP_010034024.1| PREDICTED: microfibrillar-associated protein 1-like [Eucalyptus grandis] gi|702484629|ref|XP_010034025.1| PREDICTED: microfibrillar-associated protein 1-like [Eucalyptus grandis] gi|702484633|ref|XP_010034026.1| PREDICTED: microfibrillar-associated protein 1-like [Eucalyptus grandis] gi|629087543|gb|KCW53900.1| hypothetical protein EUGRSUZ_J03113 [Eucalyptus grandis] Length = 433 Score = 59.7 bits (143), Expect = 7e-07 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -3 Query: 236 PRLRRLAESKIDNKEAVRADHRRVRQAEIVSTI 138 PRLRRLAES+IDN++ +RADHRR+RQAEIVSTI Sbjct: 74 PRLRRLAESRIDNRDEIRADHRRIRQAEIVSTI 106 >ref|XP_008231592.1| PREDICTED: microfibrillar-associated protein 1-like [Prunus mume] Length = 432 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 236 PRLRRLAESKIDNKEAVRADHRRVRQAEIVSTI 138 PRLRRLAES+IDN+E RADHRR+RQAEIVSTI Sbjct: 74 PRLRRLAESRIDNREDARADHRRIRQAEIVSTI 106 >ref|XP_007211724.1| hypothetical protein PRUPE_ppa006012mg [Prunus persica] gi|462407589|gb|EMJ12923.1| hypothetical protein PRUPE_ppa006012mg [Prunus persica] Length = 432 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 236 PRLRRLAESKIDNKEAVRADHRRVRQAEIVSTI 138 PRLRRLAES+IDN+E RADHRR+RQAEIVSTI Sbjct: 74 PRLRRLAESRIDNREDARADHRRIRQAEIVSTI 106 >ref|XP_010094194.1| hypothetical protein L484_016737 [Morus notabilis] gi|587865854|gb|EXB55370.1| hypothetical protein L484_016737 [Morus notabilis] Length = 433 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -3 Query: 236 PRLRRLAESKIDNKEAVRADHRRVRQAEIVSTI 138 PRLRRLAES++DN+E V+ADHRR+RQAEIVSTI Sbjct: 74 PRLRRLAESRMDNREEVKADHRRIRQAEIVSTI 106 >ref|XP_008799939.1| PREDICTED: microfibrillar-associated protein 1-like [Phoenix dactylifera] Length = 431 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -3 Query: 233 RLRRLAESKIDNKEAVRADHRRVRQAEIVSTI 138 RLRRLAES++DNKE VRADHRR+RQAEI+STI Sbjct: 75 RLRRLAESRVDNKEEVRADHRRIRQAEIISTI 106