BLASTX nr result
ID: Cinnamomum25_contig00003209
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00003209 (392 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514749.1| geranylgeranyl hydrogenase, putative [Ricinu... 113 4e-23 ref|XP_011071704.1| PREDICTED: geranylgeranyl diphosphate reduct... 113 4e-23 ref|XP_010939800.1| PREDICTED: geranylgeranyl diphosphate reduct... 113 6e-23 gb|ACQ41835.1| geranyl-geranyl reductase [Elaeis oleifera] 113 6e-23 dbj|BAH10639.1| geranylgeranyl reductase [Hevea brasiliensis] 112 1e-22 ref|XP_012839365.1| PREDICTED: geranylgeranyl diphosphate reduct... 112 1e-22 ref|XP_011007091.1| PREDICTED: geranylgeranyl diphosphate reduct... 111 2e-22 gb|KDO55558.1| hypothetical protein CISIN_1g012488mg [Citrus sin... 111 2e-22 emb|CBI15217.3| unnamed protein product [Vitis vinifera] 111 2e-22 ref|XP_006440606.1| hypothetical protein CICLE_v10020061mg [Citr... 111 2e-22 ref|XP_002317979.2| geranylgeranyl reductase family protein [Pop... 111 2e-22 gb|ABK95678.1| unknown [Populus trichocarpa] 111 2e-22 ref|XP_002284906.1| PREDICTED: geranylgeranyl diphosphate reduct... 111 2e-22 emb|CAN61003.1| hypothetical protein VITISV_009187 [Vitis vinifera] 111 2e-22 ref|XP_003524776.1| PREDICTED: geranylgeranyl diphosphate reduct... 110 3e-22 gb|AAD28640.2| geranylgeranyl hydrogenase [Glycine max] 110 3e-22 ref|XP_012080275.1| PREDICTED: geranylgeranyl diphosphate reduct... 110 4e-22 ref|XP_008453207.1| PREDICTED: geranylgeranyl diphosphate reduct... 110 4e-22 ref|XP_006477461.1| PREDICTED: geranylgeranyl diphosphate reduct... 110 5e-22 ref|XP_009339191.1| PREDICTED: geranylgeranyl diphosphate reduct... 109 6e-22 >ref|XP_002514749.1| geranylgeranyl hydrogenase, putative [Ricinus communis] gi|223546353|gb|EEF47855.1| geranylgeranyl hydrogenase, putative [Ricinus communis] Length = 465 Score = 113 bits (283), Expect = 4e-23 Identities = 55/58 (94%), Positives = 57/58 (98%) Frame = -3 Query: 390 AFVEMCADEYVQKMTFDSYLYKRVVPGNPLEDLKLAINTIGSLVRANALRKEMNKISV 217 AFVEMCADEYVQKMTFDSYLYKRVVPGNPL+DLKLA NTIGSLVRANALRKEMNK+SV Sbjct: 408 AFVEMCADEYVQKMTFDSYLYKRVVPGNPLDDLKLAFNTIGSLVRANALRKEMNKLSV 465 >ref|XP_011071704.1| PREDICTED: geranylgeranyl diphosphate reductase, chloroplastic [Sesamum indicum] gi|300825706|gb|ADK35887.1| geranylgeranyl reductase [Sesamum indicum] Length = 465 Score = 113 bits (283), Expect = 4e-23 Identities = 55/58 (94%), Positives = 57/58 (98%) Frame = -3 Query: 390 AFVEMCADEYVQKMTFDSYLYKRVVPGNPLEDLKLAINTIGSLVRANALRKEMNKISV 217 AFVEMCADEYVQKMTFDSYLYKRVVPGNPLEDLKLA+NTIGSLVRANALRKEM K+SV Sbjct: 408 AFVEMCADEYVQKMTFDSYLYKRVVPGNPLEDLKLAVNTIGSLVRANALRKEMEKLSV 465 >ref|XP_010939800.1| PREDICTED: geranylgeranyl diphosphate reductase, chloroplastic [Elaeis guineensis] Length = 475 Score = 113 bits (282), Expect = 6e-23 Identities = 54/58 (93%), Positives = 58/58 (100%) Frame = -3 Query: 390 AFVEMCADEYVQKMTFDSYLYKRVVPGNPLEDLKLAINTIGSLVRANALRKEMNKISV 217 AFVEMCADEYVQKMTFDSYLYKRVVPGNPLEDLKLA+NTIGSLVRANALR+EMNKI++ Sbjct: 418 AFVEMCADEYVQKMTFDSYLYKRVVPGNPLEDLKLAVNTIGSLVRANALRREMNKITL 475 >gb|ACQ41835.1| geranyl-geranyl reductase [Elaeis oleifera] Length = 207 Score = 113 bits (282), Expect = 6e-23 Identities = 54/58 (93%), Positives = 58/58 (100%) Frame = -3 Query: 390 AFVEMCADEYVQKMTFDSYLYKRVVPGNPLEDLKLAINTIGSLVRANALRKEMNKISV 217 AFVEMCADEYVQKMTFDSYLYKRVVPGNPLEDLKLA+NTIGSLVRANALR+EMNKI++ Sbjct: 150 AFVEMCADEYVQKMTFDSYLYKRVVPGNPLEDLKLAVNTIGSLVRANALRREMNKITL 207 >dbj|BAH10639.1| geranylgeranyl reductase [Hevea brasiliensis] Length = 471 Score = 112 bits (280), Expect = 1e-22 Identities = 54/58 (93%), Positives = 57/58 (98%) Frame = -3 Query: 390 AFVEMCADEYVQKMTFDSYLYKRVVPGNPLEDLKLAINTIGSLVRANALRKEMNKISV 217 AFVEMCADEYVQKMTFDSYLYK+VVPGNPL+DLKLA NTIGSLVRANALRKEMNK+SV Sbjct: 414 AFVEMCADEYVQKMTFDSYLYKKVVPGNPLDDLKLAFNTIGSLVRANALRKEMNKLSV 471 >ref|XP_012839365.1| PREDICTED: geranylgeranyl diphosphate reductase, chloroplastic [Erythranthe guttatus] gi|604330926|gb|EYU35827.1| hypothetical protein MIMGU_mgv1a027074mg [Erythranthe guttata] Length = 466 Score = 112 bits (280), Expect = 1e-22 Identities = 54/58 (93%), Positives = 57/58 (98%) Frame = -3 Query: 390 AFVEMCADEYVQKMTFDSYLYKRVVPGNPLEDLKLAINTIGSLVRANALRKEMNKISV 217 AFVEMCADEYVQ+MTFDSYLYKRVVPGNPLEDLKLA+NTIGSLVRANALRKEM K+SV Sbjct: 409 AFVEMCADEYVQRMTFDSYLYKRVVPGNPLEDLKLAVNTIGSLVRANALRKEMEKLSV 466 >ref|XP_011007091.1| PREDICTED: geranylgeranyl diphosphate reductase, chloroplastic [Populus euphratica] Length = 456 Score = 111 bits (277), Expect = 2e-22 Identities = 53/57 (92%), Positives = 57/57 (100%) Frame = -3 Query: 390 AFVEMCADEYVQKMTFDSYLYKRVVPGNPLEDLKLAINTIGSLVRANALRKEMNKIS 220 AFVEMCADEYVQKMTFDSYLYKRVVPGNPLEDLKLA+NTIGSLVRANALR+EM+K+S Sbjct: 399 AFVEMCADEYVQKMTFDSYLYKRVVPGNPLEDLKLAVNTIGSLVRANALRREMDKLS 455 >gb|KDO55558.1| hypothetical protein CISIN_1g012488mg [Citrus sinensis] Length = 462 Score = 111 bits (277), Expect = 2e-22 Identities = 52/58 (89%), Positives = 58/58 (100%) Frame = -3 Query: 390 AFVEMCADEYVQKMTFDSYLYKRVVPGNPLEDLKLAINTIGSLVRANALRKEMNKISV 217 AFVEMCADEYVQKMTFDSYLYKRVVPGNPLEDLKLA+NTIGSLVRANALR+EM+K+++ Sbjct: 405 AFVEMCADEYVQKMTFDSYLYKRVVPGNPLEDLKLAVNTIGSLVRANALRREMDKLTI 462 >emb|CBI15217.3| unnamed protein product [Vitis vinifera] Length = 351 Score = 111 bits (277), Expect = 2e-22 Identities = 53/58 (91%), Positives = 58/58 (100%) Frame = -3 Query: 390 AFVEMCADEYVQKMTFDSYLYKRVVPGNPLEDLKLAINTIGSLVRANALRKEMNKISV 217 AFVEMCADEYVQKMTFDSYLYK+VVPGNPLEDLKLA+NTIGSLVRANALR+EM+K+SV Sbjct: 294 AFVEMCADEYVQKMTFDSYLYKKVVPGNPLEDLKLAVNTIGSLVRANALRREMDKMSV 351 >ref|XP_006440606.1| hypothetical protein CICLE_v10020061mg [Citrus clementina] gi|557542868|gb|ESR53846.1| hypothetical protein CICLE_v10020061mg [Citrus clementina] Length = 462 Score = 111 bits (277), Expect = 2e-22 Identities = 52/58 (89%), Positives = 58/58 (100%) Frame = -3 Query: 390 AFVEMCADEYVQKMTFDSYLYKRVVPGNPLEDLKLAINTIGSLVRANALRKEMNKISV 217 AFVEMCADEYVQKMTFDSYLYKRVVPGNPLEDLKLA+NTIGSLVRANALR+EM+K+++ Sbjct: 405 AFVEMCADEYVQKMTFDSYLYKRVVPGNPLEDLKLAVNTIGSLVRANALRREMDKLTI 462 >ref|XP_002317979.2| geranylgeranyl reductase family protein [Populus trichocarpa] gi|550326551|gb|EEE96199.2| geranylgeranyl reductase family protein [Populus trichocarpa] Length = 470 Score = 111 bits (277), Expect = 2e-22 Identities = 53/57 (92%), Positives = 57/57 (100%) Frame = -3 Query: 390 AFVEMCADEYVQKMTFDSYLYKRVVPGNPLEDLKLAINTIGSLVRANALRKEMNKIS 220 AFVEMCADEYVQKMTFDSYLYKRVVPGNPLEDLKLA+NTIGSLVRANALR+EM+K+S Sbjct: 413 AFVEMCADEYVQKMTFDSYLYKRVVPGNPLEDLKLAVNTIGSLVRANALRREMDKLS 469 >gb|ABK95678.1| unknown [Populus trichocarpa] Length = 470 Score = 111 bits (277), Expect = 2e-22 Identities = 53/57 (92%), Positives = 57/57 (100%) Frame = -3 Query: 390 AFVEMCADEYVQKMTFDSYLYKRVVPGNPLEDLKLAINTIGSLVRANALRKEMNKIS 220 AFVEMCADEYVQKMTFDSYLYKRVVPGNPLEDLKLA+NTIGSLVRANALR+EM+K+S Sbjct: 413 AFVEMCADEYVQKMTFDSYLYKRVVPGNPLEDLKLAVNTIGSLVRANALRREMDKLS 469 >ref|XP_002284906.1| PREDICTED: geranylgeranyl diphosphate reductase, chloroplastic [Vitis vinifera] Length = 467 Score = 111 bits (277), Expect = 2e-22 Identities = 53/58 (91%), Positives = 58/58 (100%) Frame = -3 Query: 390 AFVEMCADEYVQKMTFDSYLYKRVVPGNPLEDLKLAINTIGSLVRANALRKEMNKISV 217 AFVEMCADEYVQKMTFDSYLYK+VVPGNPLEDLKLA+NTIGSLVRANALR+EM+K+SV Sbjct: 410 AFVEMCADEYVQKMTFDSYLYKKVVPGNPLEDLKLAVNTIGSLVRANALRREMDKMSV 467 >emb|CAN61003.1| hypothetical protein VITISV_009187 [Vitis vinifera] Length = 447 Score = 111 bits (277), Expect = 2e-22 Identities = 53/58 (91%), Positives = 58/58 (100%) Frame = -3 Query: 390 AFVEMCADEYVQKMTFDSYLYKRVVPGNPLEDLKLAINTIGSLVRANALRKEMNKISV 217 AFVEMCADEYVQKMTFDSYLYK+VVPGNPLEDLKLA+NTIGSLVRANALR+EM+K+SV Sbjct: 390 AFVEMCADEYVQKMTFDSYLYKKVVPGNPLEDLKLAVNTIGSLVRANALRREMDKMSV 447 >ref|XP_003524776.1| PREDICTED: geranylgeranyl diphosphate reductase, chloroplastic [Glycine max] Length = 462 Score = 110 bits (276), Expect = 3e-22 Identities = 53/58 (91%), Positives = 57/58 (98%) Frame = -3 Query: 390 AFVEMCADEYVQKMTFDSYLYKRVVPGNPLEDLKLAINTIGSLVRANALRKEMNKISV 217 AFVEMCADEYVQKMTFDSYLYK VVPGNPLEDLKLAINTIGSLVRANA+R+EMNK++V Sbjct: 405 AFVEMCADEYVQKMTFDSYLYKTVVPGNPLEDLKLAINTIGSLVRANAIRREMNKLNV 462 >gb|AAD28640.2| geranylgeranyl hydrogenase [Glycine max] Length = 462 Score = 110 bits (276), Expect = 3e-22 Identities = 53/58 (91%), Positives = 57/58 (98%) Frame = -3 Query: 390 AFVEMCADEYVQKMTFDSYLYKRVVPGNPLEDLKLAINTIGSLVRANALRKEMNKISV 217 AFVEMCADEYVQKMTFDSYLYK VVPGNPLEDLKLAINTIGSLVRANA+R+EMNK++V Sbjct: 405 AFVEMCADEYVQKMTFDSYLYKTVVPGNPLEDLKLAINTIGSLVRANAIRREMNKLNV 462 >ref|XP_012080275.1| PREDICTED: geranylgeranyl diphosphate reductase, chloroplastic [Jatropha curcas] gi|643720995|gb|KDP31259.1| hypothetical protein JCGZ_11635 [Jatropha curcas] Length = 471 Score = 110 bits (275), Expect = 4e-22 Identities = 52/58 (89%), Positives = 58/58 (100%) Frame = -3 Query: 390 AFVEMCADEYVQKMTFDSYLYKRVVPGNPLEDLKLAINTIGSLVRANALRKEMNKISV 217 AFVEMCADEYVQKMTFDSYLYKRVVPGNPL+D+KLA+NTIGSLVRANALR+EM+K+SV Sbjct: 414 AFVEMCADEYVQKMTFDSYLYKRVVPGNPLDDIKLALNTIGSLVRANALRREMDKLSV 471 >ref|XP_008453207.1| PREDICTED: geranylgeranyl diphosphate reductase, chloroplastic [Cucumis melo] gi|510379436|gb|AGN48012.1| geranylgeranyl hydrogenase [Cucumis melo] Length = 465 Score = 110 bits (275), Expect = 4e-22 Identities = 52/58 (89%), Positives = 57/58 (98%) Frame = -3 Query: 390 AFVEMCADEYVQKMTFDSYLYKRVVPGNPLEDLKLAINTIGSLVRANALRKEMNKISV 217 AFVEMCADEYVQKMTFDSYLYKRVVPGNPLEDLKLA+NTIGSLVRANAL++EM K+S+ Sbjct: 408 AFVEMCADEYVQKMTFDSYLYKRVVPGNPLEDLKLAVNTIGSLVRANALKREMEKVSL 465 >ref|XP_006477461.1| PREDICTED: geranylgeranyl diphosphate reductase, chloroplastic-like [Citrus sinensis] Length = 465 Score = 110 bits (274), Expect = 5e-22 Identities = 51/58 (87%), Positives = 58/58 (100%) Frame = -3 Query: 390 AFVEMCADEYVQKMTFDSYLYKRVVPGNPLEDLKLAINTIGSLVRANALRKEMNKISV 217 AFVEMCADEYVQKMTFDSYLYK+VVPGNPLEDLKLA+NTIGSLVRANALR+EM+K+++ Sbjct: 408 AFVEMCADEYVQKMTFDSYLYKKVVPGNPLEDLKLAVNTIGSLVRANALRREMDKLTI 465 >ref|XP_009339191.1| PREDICTED: geranylgeranyl diphosphate reductase, chloroplastic [Pyrus x bretschneideri] Length = 466 Score = 109 bits (273), Expect = 6e-22 Identities = 53/58 (91%), Positives = 56/58 (96%) Frame = -3 Query: 390 AFVEMCADEYVQKMTFDSYLYKRVVPGNPLEDLKLAINTIGSLVRANALRKEMNKISV 217 AFVEMCADEYVQKMTFDSYLYKRVVPGNP EDLKLA+NTIGSLVRANALR+EM KI+V Sbjct: 409 AFVEMCADEYVQKMTFDSYLYKRVVPGNPWEDLKLAVNTIGSLVRANALRREMEKINV 466