BLASTX nr result
ID: Cinnamomum25_contig00002656
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00002656 (222 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280836.1| PREDICTED: uncharacterized protein LOC100256... 60 6e-07 emb|CAN62284.1| hypothetical protein VITISV_034701 [Vitis vinifera] 60 6e-07 gb|KEH40570.1| 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase, ... 59 2e-06 ref|XP_010267474.1| PREDICTED: uncharacterized protein LOC104604... 58 2e-06 ref|XP_004309584.1| PREDICTED: uncharacterized protein LOC101294... 58 3e-06 gb|KDO76694.1| hypothetical protein CISIN_1g018508mg [Citrus sin... 57 5e-06 ref|XP_010053080.1| PREDICTED: uncharacterized protein LOC104441... 57 5e-06 ref|XP_006476305.1| PREDICTED: uncharacterized protein LOC102613... 57 5e-06 ref|XP_006439245.1| hypothetical protein CICLE_v10020878mg [Citr... 57 5e-06 ref|XP_009788369.1| PREDICTED: uncharacterized protein LOC104236... 56 8e-06 ref|XP_009625124.1| PREDICTED: uncharacterized protein LOC104116... 56 8e-06 ref|XP_009359567.1| PREDICTED: uncharacterized protein LOC103950... 56 8e-06 ref|XP_008390294.1| PREDICTED: uncharacterized protein LOC103452... 56 8e-06 >ref|XP_002280836.1| PREDICTED: uncharacterized protein LOC100256504 [Vitis vinifera] Length = 359 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -1 Query: 222 PEELRNRGYHMVSGTVDTGLFRSAAVEDVLRFKRCLK 112 P++LR+RGYHMVSG VD GLFRSAAVEDV +FK LK Sbjct: 304 PDDLRSRGYHMVSGAVDVGLFRSAAVEDVKKFKMGLK 340 >emb|CAN62284.1| hypothetical protein VITISV_034701 [Vitis vinifera] Length = 238 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -1 Query: 222 PEELRNRGYHMVSGTVDTGLFRSAAVEDVLRFKRCLK 112 P++LR+RGYHMVSG VD GLFRSAAVEDV +FK LK Sbjct: 183 PDDLRSRGYHMVSGAVDVGLFRSAAVEDVKKFKMGLK 219 >gb|KEH40570.1| 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase, putative [Medicago truncatula] Length = 352 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -1 Query: 222 PEELRNRGYHMVSGTVDTGLFRSAAVEDVLRFKRCL 115 P++LR+RGYHMVSG D GLFRSAAVEDV RFK L Sbjct: 295 PKDLRSRGYHMVSGATDVGLFRSAAVEDVRRFKESL 330 >ref|XP_010267474.1| PREDICTED: uncharacterized protein LOC104604700 [Nelumbo nucifera] Length = 369 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 222 PEELRNRGYHMVSGTVDTGLFRSAAVEDVLRFK 124 P+ELR RGYHM+SG VD GLFR+AAVEDV RFK Sbjct: 316 PDELRKRGYHMISGAVDIGLFRTAAVEDVRRFK 348 >ref|XP_004309584.1| PREDICTED: uncharacterized protein LOC101294232 [Fragaria vesca subsp. vesca] Length = 357 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -1 Query: 222 PEELRNRGYHMVSGTVDTGLFRSAAVEDVLRFKRCL 115 P++LR RGYHMVSG VD GLFRSAAVEDV RF+ L Sbjct: 301 PQDLRTRGYHMVSGCVDVGLFRSAAVEDVRRFRLSL 336 >gb|KDO76694.1| hypothetical protein CISIN_1g018508mg [Citrus sinensis] Length = 355 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 222 PEELRNRGYHMVSGTVDTGLFRSAAVEDVLRFK 124 P E+++RGYHMVSG VD GLFRSAAVEDV RFK Sbjct: 291 PLEMKSRGYHMVSGAVDVGLFRSAAVEDVARFK 323 >ref|XP_010053080.1| PREDICTED: uncharacterized protein LOC104441621 [Eucalyptus grandis] gi|629112368|gb|KCW77328.1| hypothetical protein EUGRSUZ_D01688 [Eucalyptus grandis] Length = 362 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = -1 Query: 222 PEELRNRGYHMVSGTVDTGLFRSAAVEDVLRFKRCLK 112 P++LR RGYHMVSG VD GLFR+AAVEDV RF+ L+ Sbjct: 303 PDDLRKRGYHMVSGAVDVGLFRNAAVEDVKRFRMGLE 339 >ref|XP_006476305.1| PREDICTED: uncharacterized protein LOC102613451 [Citrus sinensis] Length = 355 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 222 PEELRNRGYHMVSGTVDTGLFRSAAVEDVLRFK 124 P E+++RGYHMVSG VD GLFRSAAVEDV RFK Sbjct: 291 PLEMKSRGYHMVSGAVDVGLFRSAAVEDVARFK 323 >ref|XP_006439245.1| hypothetical protein CICLE_v10020878mg [Citrus clementina] gi|557541507|gb|ESR52485.1| hypothetical protein CICLE_v10020878mg [Citrus clementina] Length = 352 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 222 PEELRNRGYHMVSGTVDTGLFRSAAVEDVLRFK 124 P E+++RGYHMVSG VD GLFRSAAVEDV RFK Sbjct: 291 PLEMKSRGYHMVSGAVDVGLFRSAAVEDVARFK 323 >ref|XP_009788369.1| PREDICTED: uncharacterized protein LOC104236186 [Nicotiana sylvestris] Length = 346 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -1 Query: 222 PEELRNRGYHMVSGTVDTGLFRSAAVEDVLRFK 124 PE+L++RGYHMVSG VD GLFR+AAVEDV +FK Sbjct: 288 PEKLKSRGYHMVSGAVDIGLFRNAAVEDVKKFK 320 >ref|XP_009625124.1| PREDICTED: uncharacterized protein LOC104116055 [Nicotiana tomentosiformis] Length = 346 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -1 Query: 222 PEELRNRGYHMVSGTVDTGLFRSAAVEDVLRFK 124 PE+L++RGYHMVSG VD GLFR+AAVEDV +FK Sbjct: 288 PEKLKSRGYHMVSGAVDIGLFRNAAVEDVKKFK 320 >ref|XP_009359567.1| PREDICTED: uncharacterized protein LOC103950135 [Pyrus x bretschneideri] Length = 351 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/36 (75%), Positives = 28/36 (77%) Frame = -1 Query: 222 PEELRNRGYHMVSGTVDTGLFRSAAVEDVLRFKRCL 115 P +L RGYHMVSG VD GLFRSAAVEDV RFK L Sbjct: 295 PRDLGTRGYHMVSGAVDVGLFRSAAVEDVKRFKMSL 330 >ref|XP_008390294.1| PREDICTED: uncharacterized protein LOC103452569 [Malus domestica] Length = 356 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/36 (75%), Positives = 28/36 (77%) Frame = -1 Query: 222 PEELRNRGYHMVSGTVDTGLFRSAAVEDVLRFKRCL 115 P +L RGYHMVSG VD GLFRSAAVEDV RFK L Sbjct: 300 PRDLGTRGYHMVSGAVDVGLFRSAAVEDVKRFKMSL 335