BLASTX nr result
ID: Cinnamomum25_contig00002436
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00002436 (236 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010109932.1| Histone H2B.3 [Morus notabilis] gi|587938141... 67 5e-09 ref|XP_012471398.1| PREDICTED: histone H2B [Gossypium raimondii]... 67 5e-09 ref|NP_197679.1| histone H2B [Arabidopsis thaliana] gi|75170197... 67 5e-09 ref|XP_012843330.1| PREDICTED: probable histone H2B.1 [Erythrant... 67 5e-09 ref|XP_012572749.1| PREDICTED: probable histone H2B.1 [Cicer ari... 67 5e-09 ref|XP_012569399.1| PREDICTED: probable histone H2B.3 [Cicer ari... 67 5e-09 ref|XP_012569398.1| PREDICTED: probable histone H2B.3 [Cicer ari... 67 5e-09 ref|XP_012461908.1| PREDICTED: histone H2B-like [Gossypium raimo... 67 5e-09 ref|XP_012468377.1| PREDICTED: probable histone H2B.3 [Gossypium... 67 5e-09 ref|XP_011461274.1| PREDICTED: histone H2B-like [Fragaria vesca ... 67 5e-09 ref|XP_011461273.1| PREDICTED: histone H2B-like [Fragaria vesca ... 67 5e-09 gb|KJB83791.1| hypothetical protein B456_013G264700 [Gossypium r... 67 5e-09 ref|XP_012444709.1| PREDICTED: histone H2B-like [Gossypium raimo... 67 5e-09 ref|XP_012471389.1| PREDICTED: probable histone H2B.1 [Gossypium... 67 5e-09 gb|KJB16909.1| hypothetical protein B456_002G253900 [Gossypium r... 67 5e-09 ref|XP_012474491.1| PREDICTED: probable histone H2B.1 [Gossypium... 67 5e-09 gb|AGN92882.1| HTB2-mCherry [Binary vector pFMIRE6] 67 5e-09 ref|XP_011015660.1| PREDICTED: probable histone H2B.3 [Populus e... 67 5e-09 ref|XP_011031603.1| PREDICTED: histone H2B-like [Populus euphrat... 67 5e-09 ref|XP_011031602.1| PREDICTED: histone H2B-like [Populus euphrat... 67 5e-09 >ref|XP_010109932.1| Histone H2B.3 [Morus notabilis] gi|587938141|gb|EXC24908.1| Histone H2B.3 [Morus notabilis] Length = 146 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 140 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF 235 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF Sbjct: 56 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF 87 >ref|XP_012471398.1| PREDICTED: histone H2B [Gossypium raimondii] gi|7387726|sp|O22582.3|H2B_GOSHI RecName: Full=Histone H2B [Gossypium hirsutum] gi|2558962|gb|AAB97163.1| histone H2B1 [Gossypium hirsutum] gi|763752774|gb|KJB20162.1| hypothetical protein B456_003G136000 [Gossypium raimondii] Length = 147 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 140 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF 235 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF Sbjct: 57 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF 88 >ref|NP_197679.1| histone H2B [Arabidopsis thaliana] gi|75170197|sp|Q9FFC0.3|H2B10_ARATH RecName: Full=Histone H2B.10; AltName: Full=HTB2 gi|10177235|dbj|BAB10609.1| histone H2B like protein [Arabidopsis thaliana] gi|98960883|gb|ABF58925.1| At5g22880 [Arabidopsis thaliana] gi|332005710|gb|AED93093.1| histone H2B [Arabidopsis thaliana] Length = 145 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 140 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF 235 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF Sbjct: 55 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF 86 >ref|XP_012843330.1| PREDICTED: probable histone H2B.1 [Erythranthe guttatus] Length = 280 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 140 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF 235 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF Sbjct: 48 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF 79 Score = 66.6 bits (161), Expect = 6e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 140 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF 235 VETYKIYIFKVLKQVHPDIG+SSKAMGIMNSF Sbjct: 190 VETYKIYIFKVLKQVHPDIGVSSKAMGIMNSF 221 >ref|XP_012572749.1| PREDICTED: probable histone H2B.1 [Cicer arietinum] gi|828320856|ref|XP_012572750.1| PREDICTED: probable histone H2B.1 [Cicer arietinum] Length = 149 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 140 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF 235 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF Sbjct: 59 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF 90 >ref|XP_012569399.1| PREDICTED: probable histone H2B.3 [Cicer arietinum] Length = 139 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 140 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF 235 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF Sbjct: 49 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF 80 >ref|XP_012569398.1| PREDICTED: probable histone H2B.3 [Cicer arietinum] Length = 139 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 140 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF 235 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF Sbjct: 49 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF 80 >ref|XP_012461908.1| PREDICTED: histone H2B-like [Gossypium raimondii] Length = 288 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 140 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF 235 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF Sbjct: 198 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF 229 Score = 65.5 bits (158), Expect = 1e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 143 ETYKIYIFKVLKQVHPDIGISSKAMGIMNSF 235 ETYKIYIFKVLKQVHPDIGISSKAMGIMNSF Sbjct: 58 ETYKIYIFKVLKQVHPDIGISSKAMGIMNSF 88 >ref|XP_012468377.1| PREDICTED: probable histone H2B.3 [Gossypium raimondii] Length = 138 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 140 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF 235 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF Sbjct: 48 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF 79 >ref|XP_011461274.1| PREDICTED: histone H2B-like [Fragaria vesca subsp. vesca] Length = 284 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 140 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF 235 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF Sbjct: 55 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF 86 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 140 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF 235 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF Sbjct: 194 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF 225 >ref|XP_011461273.1| PREDICTED: histone H2B-like [Fragaria vesca subsp. vesca] Length = 135 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 140 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF 235 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF Sbjct: 45 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF 76 >gb|KJB83791.1| hypothetical protein B456_013G264700 [Gossypium raimondii] Length = 142 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 140 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF 235 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF Sbjct: 57 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF 88 >ref|XP_012444709.1| PREDICTED: histone H2B-like [Gossypium raimondii] gi|763788708|gb|KJB55704.1| hypothetical protein B456_009G089900 [Gossypium raimondii] Length = 141 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 140 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF 235 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF Sbjct: 51 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF 82 >ref|XP_012471389.1| PREDICTED: probable histone H2B.1 [Gossypium raimondii] gi|763752764|gb|KJB20152.1| hypothetical protein B456_003G135400 [Gossypium raimondii] Length = 147 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 140 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF 235 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF Sbjct: 57 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF 88 >gb|KJB16909.1| hypothetical protein B456_002G253900 [Gossypium raimondii] Length = 217 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 140 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF 235 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF Sbjct: 127 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF 158 >ref|XP_012474491.1| PREDICTED: probable histone H2B.1 [Gossypium raimondii] gi|763741356|gb|KJB08855.1| hypothetical protein B456_001G108300 [Gossypium raimondii] Length = 151 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 140 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF 235 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF Sbjct: 61 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF 92 >gb|AGN92882.1| HTB2-mCherry [Binary vector pFMIRE6] Length = 387 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 140 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF 235 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF Sbjct: 55 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF 86 >ref|XP_011015660.1| PREDICTED: probable histone H2B.3 [Populus euphratica] Length = 139 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 140 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF 235 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF Sbjct: 49 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF 80 >ref|XP_011031603.1| PREDICTED: histone H2B-like [Populus euphratica] Length = 139 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 140 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF 235 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF Sbjct: 49 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF 80 >ref|XP_011031602.1| PREDICTED: histone H2B-like [Populus euphratica] Length = 139 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 140 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF 235 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF Sbjct: 49 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSF 80