BLASTX nr result
ID: Cinnamomum25_contig00001891
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00001891 (660 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009415551.1| PREDICTED: small nuclear ribonucleoprotein S... 68 4e-09 ref|XP_002302121.1| small nuclear ribonucleoprotein D1 [Populus ... 68 5e-09 ref|XP_003590660.1| Small nuclear ribonucleoprotein Sm D1 [Medic... 67 6e-09 ref|XP_011095613.1| PREDICTED: small nuclear ribonucleoprotein S... 67 8e-09 ref|XP_011079833.1| PREDICTED: small nuclear ribonucleoprotein S... 67 8e-09 ref|XP_011079832.1| PREDICTED: small nuclear ribonucleoprotein S... 67 8e-09 ref|XP_010929011.1| PREDICTED: small nuclear ribonucleoprotein S... 67 8e-09 ref|XP_008803650.1| PREDICTED: small nuclear ribonucleoprotein S... 67 8e-09 ref|XP_002520764.1| small nuclear ribonucleoprotein sm d1, putat... 67 8e-09 ref|XP_007162409.1| hypothetical protein PHAVU_001G149700g [Phas... 67 8e-09 ref|XP_006857628.1| PREDICTED: small nuclear ribonucleoprotein S... 67 8e-09 gb|EPS67294.1| hypothetical protein M569_07483, partial [Genlise... 67 8e-09 ref|XP_007050651.1| Small nuclear ribonucleoprotein family prote... 67 8e-09 ref|XP_004150106.1| PREDICTED: small nuclear ribonucleoprotein S... 67 8e-09 ref|XP_010070238.1| PREDICTED: small nuclear ribonucleoprotein S... 67 1e-08 ref|XP_004290666.1| PREDICTED: small nuclear ribonucleoprotein S... 67 1e-08 ref|XP_008350062.1| PREDICTED: small nuclear ribonucleoprotein S... 66 1e-08 ref|XP_010038105.1| PREDICTED: small nuclear ribonucleoprotein S... 66 1e-08 emb|CBI32365.3| unnamed protein product [Vitis vinifera] 66 1e-08 ref|XP_002277211.1| PREDICTED: small nuclear ribonucleoprotein S... 66 1e-08 >ref|XP_009415551.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like [Musa acuminata subsp. malaccensis] Length = 114 Score = 68.2 bits (165), Expect = 4e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 658 IRYYILPDSLNLETLLVEEAPRVKPKKPTAGRSL 557 IRYYILPDSLNLETLLVEE PRVKPKKPTAGRS+ Sbjct: 65 IRYYILPDSLNLETLLVEETPRVKPKKPTAGRSM 98 >ref|XP_002302121.1| small nuclear ribonucleoprotein D1 [Populus trichocarpa] gi|118482633|gb|ABK93236.1| unknown [Populus trichocarpa] gi|118488779|gb|ABK96200.1| unknown [Populus trichocarpa] gi|222843847|gb|EEE81394.1| small nuclear ribonucleoprotein D1 [Populus trichocarpa] Length = 115 Score = 67.8 bits (164), Expect = 5e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 658 IRYYILPDSLNLETLLVEEAPRVKPKKPTAGRSL 557 IRYYILPDSLNLETLLVEE PRVKPKKPTAGR+L Sbjct: 65 IRYYILPDSLNLETLLVEETPRVKPKKPTAGRAL 98 >ref|XP_003590660.1| Small nuclear ribonucleoprotein Sm D1 [Medicago truncatula] gi|502109481|ref|XP_004493656.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like [Cicer arietinum] gi|502115492|ref|XP_004495217.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like [Cicer arietinum] gi|355479708|gb|AES60911.1| small nuclear ribonucleoprotein [Medicago truncatula] Length = 114 Score = 67.4 bits (163), Expect = 6e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 658 IRYYILPDSLNLETLLVEEAPRVKPKKPTAGRSL 557 IRYYILPDSLNLETLLVEEAPRVKPKKPTAG+ L Sbjct: 65 IRYYILPDSLNLETLLVEEAPRVKPKKPTAGKPL 98 >ref|XP_011095613.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like [Sesamum indicum] Length = 114 Score = 67.0 bits (162), Expect = 8e-09 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -3 Query: 658 IRYYILPDSLNLETLLVEEAPRVKPKKPTAGRSL 557 IRYYILPDSLNLETLLVEE PRVKPKKPTAGR L Sbjct: 65 IRYYILPDSLNLETLLVEETPRVKPKKPTAGRPL 98 >ref|XP_011079833.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like isoform X2 [Sesamum indicum] Length = 107 Score = 67.0 bits (162), Expect = 8e-09 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -3 Query: 658 IRYYILPDSLNLETLLVEEAPRVKPKKPTAGRSL 557 IRYYILPDSLNLETLLVEE PRVKPKKPTAGR L Sbjct: 58 IRYYILPDSLNLETLLVEETPRVKPKKPTAGRPL 91 >ref|XP_011079832.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like isoform X1 [Sesamum indicum] Length = 114 Score = 67.0 bits (162), Expect = 8e-09 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -3 Query: 658 IRYYILPDSLNLETLLVEEAPRVKPKKPTAGRSL 557 IRYYILPDSLNLETLLVEE PRVKPKKPTAGR L Sbjct: 65 IRYYILPDSLNLETLLVEETPRVKPKKPTAGRPL 98 >ref|XP_010929011.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like isoform X2 [Elaeis guineensis] Length = 110 Score = 67.0 bits (162), Expect = 8e-09 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -3 Query: 658 IRYYILPDSLNLETLLVEEAPRVKPKKPTAGRSL 557 IRYYILPDSLNLETLLVEE PRVKPKKPTAGR L Sbjct: 61 IRYYILPDSLNLETLLVEETPRVKPKKPTAGRPL 94 >ref|XP_008803650.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like [Phoenix dactylifera] Length = 107 Score = 67.0 bits (162), Expect = 8e-09 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -3 Query: 658 IRYYILPDSLNLETLLVEEAPRVKPKKPTAGRSL 557 IRYYILPDSLNLETLLVEE PRVKPKKPTAGR L Sbjct: 58 IRYYILPDSLNLETLLVEETPRVKPKKPTAGRPL 91 >ref|XP_002520764.1| small nuclear ribonucleoprotein sm d1, putative [Ricinus communis] gi|743807194|ref|XP_010928024.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like [Elaeis guineensis] gi|223540149|gb|EEF41726.1| small nuclear ribonucleoprotein sm d1, putative [Ricinus communis] Length = 114 Score = 67.0 bits (162), Expect = 8e-09 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -3 Query: 658 IRYYILPDSLNLETLLVEEAPRVKPKKPTAGRSL 557 IRYYILPDSLNLETLLVEE PRVKPKKPTAGR L Sbjct: 65 IRYYILPDSLNLETLLVEETPRVKPKKPTAGRPL 98 >ref|XP_007162409.1| hypothetical protein PHAVU_001G149700g [Phaseolus vulgaris] gi|561035873|gb|ESW34403.1| hypothetical protein PHAVU_001G149700g [Phaseolus vulgaris] Length = 114 Score = 67.0 bits (162), Expect = 8e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 658 IRYYILPDSLNLETLLVEEAPRVKPKKPTAGRSL 557 IRYYILPDSLNLETLLVEEAPR+KPKKPTAG+ L Sbjct: 65 IRYYILPDSLNLETLLVEEAPRIKPKKPTAGKPL 98 >ref|XP_006857628.1| PREDICTED: small nuclear ribonucleoprotein Sm D1 [Amborella trichopoda] gi|743763980|ref|XP_010912191.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like [Elaeis guineensis] gi|743810858|ref|XP_010929010.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like isoform X1 [Elaeis guineensis] gi|548861724|gb|ERN19095.1| hypothetical protein AMTR_s00061p00127560 [Amborella trichopoda] Length = 114 Score = 67.0 bits (162), Expect = 8e-09 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -3 Query: 658 IRYYILPDSLNLETLLVEEAPRVKPKKPTAGRSL 557 IRYYILPDSLNLETLLVEE PRVKPKKPTAGR L Sbjct: 65 IRYYILPDSLNLETLLVEETPRVKPKKPTAGRPL 98 >gb|EPS67294.1| hypothetical protein M569_07483, partial [Genlisea aurea] Length = 116 Score = 67.0 bits (162), Expect = 8e-09 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -3 Query: 658 IRYYILPDSLNLETLLVEEAPRVKPKKPTAGRSL 557 IRYYILPDSLNLETLLVEE PRVKPKKPTAGR L Sbjct: 67 IRYYILPDSLNLETLLVEETPRVKPKKPTAGRPL 100 >ref|XP_007050651.1| Small nuclear ribonucleoprotein family protein, partial [Theobroma cacao] gi|508702912|gb|EOX94808.1| Small nuclear ribonucleoprotein family protein, partial [Theobroma cacao] Length = 174 Score = 67.0 bits (162), Expect = 8e-09 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -3 Query: 658 IRYYILPDSLNLETLLVEEAPRVKPKKPTAGRSL 557 IRYYILPDSLNLETLLVEE PRVKPKKPTAGR L Sbjct: 125 IRYYILPDSLNLETLLVEETPRVKPKKPTAGRPL 158 >ref|XP_004150106.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like [Cucumis sativus] gi|659109328|ref|XP_008454659.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like [Cucumis melo] gi|700204757|gb|KGN59890.1| hypothetical protein Csa_3G851900 [Cucumis sativus] Length = 114 Score = 67.0 bits (162), Expect = 8e-09 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -3 Query: 658 IRYYILPDSLNLETLLVEEAPRVKPKKPTAGRSL 557 IRYYILPDSLNLETLLVEE PRVKPKKPTAGR L Sbjct: 65 IRYYILPDSLNLETLLVEETPRVKPKKPTAGRPL 98 >ref|XP_010070238.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like [Eucalyptus grandis] Length = 114 Score = 66.6 bits (161), Expect = 1e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 658 IRYYILPDSLNLETLLVEEAPRVKPKKPTAGRSL 557 IRYYILPDSLNLETLLVEE PRVKPKKPTAGR++ Sbjct: 65 IRYYILPDSLNLETLLVEETPRVKPKKPTAGRAV 98 >ref|XP_004290666.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like [Fragaria vesca subsp. vesca] Length = 115 Score = 66.6 bits (161), Expect = 1e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 658 IRYYILPDSLNLETLLVEEAPRVKPKKPTAGRSL 557 IRYYILPDSLNLETLLVEE PRVKPKKPTAGR++ Sbjct: 65 IRYYILPDSLNLETLLVEETPRVKPKKPTAGRAV 98 >ref|XP_008350062.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like [Malus domestica] gi|694332236|ref|XP_009356762.1| PREDICTED: small nuclear ribonucleoprotein Sm D1 [Pyrus x bretschneideri] Length = 114 Score = 66.2 bits (160), Expect = 1e-08 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -3 Query: 658 IRYYILPDSLNLETLLVEEAPRVKPKKPTAGRSL 557 IRYYILPDSLNLETLLVEE PRVKPKKPTAGR + Sbjct: 65 IRYYILPDSLNLETLLVEETPRVKPKKPTAGRPM 98 >ref|XP_010038105.1| PREDICTED: small nuclear ribonucleoprotein Sm D1 [Eucalyptus grandis] gi|629083467|gb|KCW49912.1| hypothetical protein EUGRSUZ_K03379 [Eucalyptus grandis] Length = 114 Score = 66.2 bits (160), Expect = 1e-08 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -3 Query: 658 IRYYILPDSLNLETLLVEEAPRVKPKKPTAGRSL 557 IRYYILPDS+NLETLLVEE PRVKPKKPTAGR++ Sbjct: 65 IRYYILPDSINLETLLVEETPRVKPKKPTAGRAM 98 >emb|CBI32365.3| unnamed protein product [Vitis vinifera] Length = 144 Score = 66.2 bits (160), Expect = 1e-08 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -3 Query: 658 IRYYILPDSLNLETLLVEEAPRVKPKKPTAGRSL 557 IRYYILPDSLNLETLLVEE PRVKPKKPTAGR + Sbjct: 95 IRYYILPDSLNLETLLVEETPRVKPKKPTAGRPM 128 >ref|XP_002277211.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like [Vitis vinifera] gi|225436988|ref|XP_002277231.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like [Vitis vinifera] gi|731395359|ref|XP_010652146.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like [Vitis vinifera] Length = 114 Score = 66.2 bits (160), Expect = 1e-08 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -3 Query: 658 IRYYILPDSLNLETLLVEEAPRVKPKKPTAGRSL 557 IRYYILPDSLNLETLLVEE PRVKPKKPTAGR + Sbjct: 65 IRYYILPDSLNLETLLVEETPRVKPKKPTAGRPM 98