BLASTX nr result
ID: Cinnamomum25_contig00001844
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00001844 (562 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010271919.1| PREDICTED: glutathione transferase GST 23-li... 54 3e-08 >ref|XP_010271919.1| PREDICTED: glutathione transferase GST 23-like [Nelumbo nucifera] Length = 223 Score = 53.5 bits (127), Expect(2) = 3e-08 Identities = 25/45 (55%), Positives = 30/45 (66%) Frame = -3 Query: 560 PYERAMARFWAKYNDEKPWLTVFGAFSKTGXXXXXXXXXAQETLK 426 PYERAMARFWAK+ D+K W T+ G F+KTG A E+LK Sbjct: 89 PYERAMARFWAKFADDKCWTTIHGVFTKTGQEQENAKSEAIESLK 133 Score = 31.2 bits (69), Expect(2) = 3e-08 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -2 Query: 339 GVTFVDESTLPLLHAWFQEFSNIPLV 262 G+ V E +LP L WF+ F ++PLV Sbjct: 172 GIILVGEDSLPSLKEWFKNFLDVPLV 197