BLASTX nr result
ID: Cinnamomum25_contig00001336
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00001336 (233 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004498656.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 60 7e-07 gb|KMT16818.1| hypothetical protein BVRB_2g043020 isoform C [Bet... 59 1e-06 ref|XP_010670673.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 59 1e-06 ref|XP_010670670.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 59 1e-06 ref|XP_008394052.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 59 1e-06 ref|XP_008394051.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 59 1e-06 gb|KJB07784.1| hypothetical protein B456_001G045000 [Gossypium r... 59 1e-06 ref|XP_012460515.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 59 1e-06 ref|XP_012460724.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 59 1e-06 gb|KHG19968.1| Peptidyl-prolyl cis-trans isomerase cyp5 [Gossypi... 59 1e-06 ref|XP_012461479.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 59 2e-06 ref|XP_012461450.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 59 2e-06 ref|XP_012461408.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 59 2e-06 ref|XP_012461340.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 59 2e-06 ref|XP_012460903.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 59 2e-06 ref|XP_012461377.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 59 2e-06 ref|XP_009345297.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 59 2e-06 ref|XP_009334770.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 59 2e-06 ref|XP_009334769.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 59 2e-06 ref|XP_007013820.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 ... 59 2e-06 >ref|XP_004498656.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform X1 [Cicer arietinum] gi|502124751|ref|XP_004498657.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform X1 [Cicer arietinum] gi|828308561|ref|XP_012570690.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform X1 [Cicer arietinum] gi|828308563|ref|XP_012570691.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform X1 [Cicer arietinum] Length = 773 Score = 59.7 bits (143), Expect = 7e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -3 Query: 105 MSKKKNPMVFLDVSIDGSPPERMIFELCDDIVPKT 1 M+KKKNPMVFLDVSIDG P ERM+FEL D+ PKT Sbjct: 1 MAKKKNPMVFLDVSIDGDPAERMVFELFYDVAPKT 35 >gb|KMT16818.1| hypothetical protein BVRB_2g043020 isoform C [Beta vulgaris subsp. vulgaris] Length = 782 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -3 Query: 105 MSKKKNPMVFLDVSIDGSPPERMIFELCDDIVPKT 1 M+KK+NP+VFLDVSIDG P ERM+FEL D+VPKT Sbjct: 1 MAKKRNPLVFLDVSIDGDPYERMVFELFSDVVPKT 35 >ref|XP_010670673.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X2 [Beta vulgaris subsp. vulgaris] gi|870865779|gb|KMT16817.1| hypothetical protein BVRB_2g043020 isoform B [Beta vulgaris subsp. vulgaris] Length = 765 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -3 Query: 105 MSKKKNPMVFLDVSIDGSPPERMIFELCDDIVPKT 1 M+KK+NP+VFLDVSIDG P ERM+FEL D+VPKT Sbjct: 1 MAKKRNPLVFLDVSIDGDPYERMVFELFSDVVPKT 35 >ref|XP_010670670.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X1 [Beta vulgaris subsp. vulgaris] gi|731320186|ref|XP_010670671.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X1 [Beta vulgaris subsp. vulgaris] gi|731320188|ref|XP_010670672.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X1 [Beta vulgaris subsp. vulgaris] gi|870865778|gb|KMT16816.1| hypothetical protein BVRB_2g043020 isoform A [Beta vulgaris subsp. vulgaris] Length = 768 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -3 Query: 105 MSKKKNPMVFLDVSIDGSPPERMIFELCDDIVPKT 1 M+KK+NP+VFLDVSIDG P ERM+FEL D+VPKT Sbjct: 1 MAKKRNPLVFLDVSIDGDPYERMVFELFSDVVPKT 35 >ref|XP_008394052.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8 isoform X2 [Malus domestica] Length = 835 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = -3 Query: 105 MSKKKNPMVFLDVSIDGSPPERMIFELCDDIVPKT 1 M+KKKNP+VF+DVS+DG P ERM+FEL D+VPKT Sbjct: 1 MTKKKNPLVFMDVSVDGDPYERMVFELFSDVVPKT 35 >ref|XP_008394051.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G isoform X1 [Malus domestica] Length = 856 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = -3 Query: 105 MSKKKNPMVFLDVSIDGSPPERMIFELCDDIVPKT 1 M+KKKNP+VF+DVS+DG P ERM+FEL D+VPKT Sbjct: 1 MTKKKNPLVFMDVSVDGDPYERMVFELFSDVVPKT 35 >gb|KJB07784.1| hypothetical protein B456_001G045000 [Gossypium raimondii] Length = 722 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -3 Query: 105 MSKKKNPMVFLDVSIDGSPPERMIFELCDDIVPKT 1 M+KKKNP+VF+DVSIDG P ERM+FEL DI PKT Sbjct: 1 MAKKKNPLVFMDVSIDGDPAERMVFELFPDIAPKT 35 >ref|XP_012460515.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform X1 [Gossypium raimondii] gi|823121246|ref|XP_012460594.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform X1 [Gossypium raimondii] gi|823121248|ref|XP_012460657.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform X1 [Gossypium raimondii] gi|763740277|gb|KJB07776.1| hypothetical protein B456_001G045000 [Gossypium raimondii] gi|763740278|gb|KJB07777.1| hypothetical protein B456_001G045000 [Gossypium raimondii] gi|763740288|gb|KJB07787.1| hypothetical protein B456_001G045000 [Gossypium raimondii] gi|763740289|gb|KJB07788.1| hypothetical protein B456_001G045000 [Gossypium raimondii] Length = 801 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -3 Query: 105 MSKKKNPMVFLDVSIDGSPPERMIFELCDDIVPKT 1 M+KKKNP+VF+DVSIDG P ERM+FEL DI PKT Sbjct: 1 MAKKKNPLVFMDVSIDGDPAERMVFELFPDIAPKT 35 >ref|XP_012460724.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform X2 [Gossypium raimondii] gi|763740276|gb|KJB07775.1| hypothetical protein B456_001G045000 [Gossypium raimondii] gi|763740279|gb|KJB07778.1| hypothetical protein B456_001G045000 [Gossypium raimondii] gi|763740286|gb|KJB07785.1| hypothetical protein B456_001G045000 [Gossypium raimondii] Length = 799 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -3 Query: 105 MSKKKNPMVFLDVSIDGSPPERMIFELCDDIVPKT 1 M+KKKNP+VF+DVSIDG P ERM+FEL DI PKT Sbjct: 1 MAKKKNPLVFMDVSIDGDPAERMVFELFPDIAPKT 35 >gb|KHG19968.1| Peptidyl-prolyl cis-trans isomerase cyp5 [Gossypium arboreum] Length = 702 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -3 Query: 105 MSKKKNPMVFLDVSIDGSPPERMIFELCDDIVPKT 1 M+KKKNP+VF+DVSIDG P ERM+FEL DI PKT Sbjct: 1 MAKKKNPLVFMDVSIDGDPAERMVFELFPDIAPKT 35 >ref|XP_012461479.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform X6 [Gossypium raimondii] Length = 691 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -3 Query: 105 MSKKKNPMVFLDVSIDGSPPERMIFELCDDIVPKT 1 M+KKKNP+VF+DVSIDG P ERM+FEL DI PKT Sbjct: 1 MAKKKNPLVFMDVSIDGDPVERMVFELFPDIAPKT 35 >ref|XP_012461450.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform X5 [Gossypium raimondii] Length = 783 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -3 Query: 105 MSKKKNPMVFLDVSIDGSPPERMIFELCDDIVPKT 1 M+KKKNP+VF+DVSIDG P ERM+FEL DI PKT Sbjct: 1 MAKKKNPLVFMDVSIDGDPVERMVFELFPDIAPKT 35 >ref|XP_012461408.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform X4 [Gossypium raimondii] Length = 785 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -3 Query: 105 MSKKKNPMVFLDVSIDGSPPERMIFELCDDIVPKT 1 M+KKKNP+VF+DVSIDG P ERM+FEL DI PKT Sbjct: 1 MAKKKNPLVFMDVSIDGDPVERMVFELFPDIAPKT 35 >ref|XP_012461340.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform X2 [Gossypium raimondii] Length = 792 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -3 Query: 105 MSKKKNPMVFLDVSIDGSPPERMIFELCDDIVPKT 1 M+KKKNP+VF+DVSIDG P ERM+FEL DI PKT Sbjct: 1 MAKKKNPLVFMDVSIDGDPVERMVFELFPDIAPKT 35 >ref|XP_012460903.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform X1 [Gossypium raimondii] gi|823121256|ref|XP_012460972.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform X1 [Gossypium raimondii] gi|823121258|ref|XP_012461046.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform X1 [Gossypium raimondii] gi|823121260|ref|XP_012461103.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform X1 [Gossypium raimondii] gi|823121262|ref|XP_012461147.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform X1 [Gossypium raimondii] gi|823121264|ref|XP_012461188.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform X1 [Gossypium raimondii] gi|823121266|ref|XP_012461237.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform X1 [Gossypium raimondii] gi|823121268|ref|XP_012461289.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform X1 [Gossypium raimondii] Length = 794 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -3 Query: 105 MSKKKNPMVFLDVSIDGSPPERMIFELCDDIVPKT 1 M+KKKNP+VF+DVSIDG P ERM+FEL DI PKT Sbjct: 1 MAKKKNPLVFMDVSIDGDPVERMVFELFPDIAPKT 35 >ref|XP_012461377.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform X3 [Gossypium raimondii] gi|763740271|gb|KJB07770.1| hypothetical protein B456_001G044900 [Gossypium raimondii] gi|763740272|gb|KJB07771.1| hypothetical protein B456_001G044900 [Gossypium raimondii] gi|763740273|gb|KJB07772.1| hypothetical protein B456_001G044900 [Gossypium raimondii] gi|763740274|gb|KJB07773.1| hypothetical protein B456_001G044900 [Gossypium raimondii] Length = 787 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -3 Query: 105 MSKKKNPMVFLDVSIDGSPPERMIFELCDDIVPKT 1 M+KKKNP+VF+DVSIDG P ERM+FEL DI PKT Sbjct: 1 MAKKKNPLVFMDVSIDGDPVERMVFELFPDIAPKT 35 >ref|XP_009345297.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Pyrus x bretschneideri] Length = 1043 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -3 Query: 105 MSKKKNPMVFLDVSIDGSPPERMIFELCDDIVPKT 1 M+KKKNP VF+DVS+DG P ERM+FEL D+VPKT Sbjct: 1 MTKKKNPFVFMDVSVDGDPYERMVFELFSDVVPKT 35 >ref|XP_009334770.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform X2 [Pyrus x bretschneideri] Length = 846 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -3 Query: 105 MSKKKNPMVFLDVSIDGSPPERMIFELCDDIVPKT 1 M+KKKNP VF+DVS+DG P ERM+FEL D+VPKT Sbjct: 1 MTKKKNPFVFMDVSVDGDPYERMVFELFSDVVPKT 35 >ref|XP_009334769.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform X1 [Pyrus x bretschneideri] Length = 854 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -3 Query: 105 MSKKKNPMVFLDVSIDGSPPERMIFELCDDIVPKT 1 M+KKKNP VF+DVS+DG P ERM+FEL D+VPKT Sbjct: 1 MTKKKNPFVFMDVSVDGDPYERMVFELFSDVVPKT 35 >ref|XP_007013820.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 4 [Theobroma cacao] gi|508784183|gb|EOY31439.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 4 [Theobroma cacao] Length = 858 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -3 Query: 105 MSKKKNPMVFLDVSIDGSPPERMIFELCDDIVPKT 1 M+KKKNP+VF+DVS+DG P ERMIFEL DI PKT Sbjct: 16 MAKKKNPLVFMDVSVDGDPVERMIFELFPDIAPKT 50