BLASTX nr result
ID: Cinnamomum25_contig00000437
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00000437 (244 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value prf||2203261A Cys protease inhibitor 76 1e-11 ref|XP_010244435.1| PREDICTED: cysteine proteinase inhibitor 12-... 65 2e-08 ref|XP_011620718.1| PREDICTED: cysteine proteinase inhibitor iso... 64 5e-08 ref|XP_006836222.2| PREDICTED: cysteine proteinase inhibitor 6 i... 64 5e-08 ref|XP_009361915.1| PREDICTED: cysteine proteinase inhibitor A-l... 64 5e-08 gb|AAB71505.1| cysteine protease inhibitor [Pyrus communis] 64 5e-08 gb|ERM99075.1| hypothetical protein AMTR_s00101p00100170 [Ambore... 64 5e-08 ref|NP_850570.2| cysteine proteinase inhibitor 6 [Arabidopsis th... 63 7e-08 gb|ACN85343.1| cystatin [Camellia sinensis] gi|225216854|gb|ACN8... 63 7e-08 gb|AAN65082.1| cysteine proteinase inhibitor, putative 1 [Arabid... 63 7e-08 ref|NP_566425.1| cysteine proteinase inhibitor 6 [Arabidopsis th... 63 7e-08 gb|KHN37731.1| Cysteine proteinase inhibitor 12 [Glycine soja] 63 9e-08 ref|XP_010241469.1| PREDICTED: cysteine proteinase inhibitor 12-... 62 1e-07 gb|AEK84226.1| cysteine protease inhibitor [Cucurbita maxima] 62 1e-07 gb|KHN11196.1| Cysteine proteinase inhibitor 12 [Glycine soja] 62 2e-07 ref|XP_010520100.1| PREDICTED: cysteine proteinase inhibitor 6 [... 62 2e-07 ref|NP_001237734.1| cysteine proteinase inhibitor precursor [Gly... 62 2e-07 gb|ACU24145.1| unknown [Glycine max] 62 2e-07 emb|CAD21441.1| putative cysteine proteinase inhibitor [Rumex ob... 62 2e-07 gb|KJB68715.1| hypothetical protein B456_011G2218002 [Gossypium ... 61 3e-07 >prf||2203261A Cys protease inhibitor Length = 100 Score = 75.9 bits (185), Expect = 1e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -1 Query: 244 GQKKIYEAKVWVKPWENFKQLQEFKPVGDSSSTSSDA 134 GQKKIYEAKVWVK WENFK+LQEFKPVGDSSSTSSDA Sbjct: 64 GQKKIYEAKVWVKLWENFKELQEFKPVGDSSSTSSDA 100 >ref|XP_010244435.1| PREDICTED: cysteine proteinase inhibitor 12-like [Nelumbo nucifera] Length = 239 Score = 64.7 bits (156), Expect = 2e-08 Identities = 30/37 (81%), Positives = 34/37 (91%), Gaps = 1/37 (2%) Frame = -1 Query: 244 GQKKIYEAKVWVKPWENFKQLQEFKPVGDSSS-TSSD 137 G+KKIYEAKVWVKPW NFK+LQEFKPVGD+ + TSSD Sbjct: 104 GKKKIYEAKVWVKPWLNFKELQEFKPVGDAPTFTSSD 140 >ref|XP_011620718.1| PREDICTED: cysteine proteinase inhibitor isoform X2 [Amborella trichopoda] Length = 128 Score = 63.5 bits (153), Expect = 5e-08 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -1 Query: 244 GQKKIYEAKVWVKPWENFKQLQEFKPVGDSSSTSSD 137 G+ K+YEAKVW+KPWENFK+L+EF VGDSS TSSD Sbjct: 86 GKNKLYEAKVWLKPWENFKELKEFNHVGDSSLTSSD 121 >ref|XP_006836222.2| PREDICTED: cysteine proteinase inhibitor 6 isoform X1 [Amborella trichopoda] Length = 225 Score = 63.5 bits (153), Expect = 5e-08 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -1 Query: 244 GQKKIYEAKVWVKPWENFKQLQEFKPVGDSSSTSSD 137 G+ K+YEAKVW+KPWENFK+L+EF VGDSS TSSD Sbjct: 86 GKNKLYEAKVWLKPWENFKELKEFNHVGDSSLTSSD 121 >ref|XP_009361915.1| PREDICTED: cysteine proteinase inhibitor A-like [Pyrus x bretschneideri] Length = 95 Score = 63.5 bits (153), Expect = 5e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 244 GQKKIYEAKVWVKPWENFKQLQEFKPVGDS 155 G+KK+YEAKVWVKPWENFKQ+QEFKPV DS Sbjct: 66 GKKKVYEAKVWVKPWENFKQVQEFKPVSDS 95 >gb|AAB71505.1| cysteine protease inhibitor [Pyrus communis] Length = 95 Score = 63.5 bits (153), Expect = 5e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 244 GQKKIYEAKVWVKPWENFKQLQEFKPVGDS 155 G+KK+YEAKVWVKPWENFKQ+QEFKPV DS Sbjct: 66 GKKKVYEAKVWVKPWENFKQVQEFKPVSDS 95 >gb|ERM99075.1| hypothetical protein AMTR_s00101p00100170 [Amborella trichopoda] Length = 206 Score = 63.5 bits (153), Expect = 5e-08 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -1 Query: 244 GQKKIYEAKVWVKPWENFKQLQEFKPVGDSSSTSSD 137 G+ K+YEAKVW+KPWENFK+L+EF VGDSS TSSD Sbjct: 67 GKNKLYEAKVWLKPWENFKELKEFNHVGDSSLTSSD 102 >ref|NP_850570.2| cysteine proteinase inhibitor 6 [Arabidopsis thaliana] gi|125991833|sp|Q8H0X6.2|CYT6_ARATH RecName: Full=Cysteine proteinase inhibitor 6; Short=AtCYS-6; AltName: Full=PIP-M; AltName: Full=PRLI-interacting factor M; Flags: Precursor gi|12321971|gb|AAG51028.1|AC069474_27 cysteine proteinase inhibitor, putative; 65918-67271 [Arabidopsis thaliana] gi|15795168|dbj|BAB03156.1| cysteine proteinase inhibitor-like protein [Arabidopsis thaliana] gi|332641680|gb|AEE75201.1| cysteine proteinase inhibitor 6 [Arabidopsis thaliana] Length = 234 Score = 63.2 bits (152), Expect = 7e-08 Identities = 29/40 (72%), Positives = 33/40 (82%), Gaps = 1/40 (2%) Frame = -1 Query: 244 GQKKIYEAKVWVKPWENFKQLQEFKPVGDSSS-TSSDA*C 128 GQKK+YEAKVWVKPW NFK+LQEFKP D+ + TSSD C Sbjct: 99 GQKKLYEAKVWVKPWLNFKELQEFKPASDAPAITSSDLGC 138 >gb|ACN85343.1| cystatin [Camellia sinensis] gi|225216854|gb|ACN85344.1| cystatin [Camellia sinensis] Length = 101 Score = 63.2 bits (152), Expect = 7e-08 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -1 Query: 244 GQKKIYEAKVWVKPWENFKQLQEFKPVGDSSSTSS 140 GQKK YEAKVWVKPW NFK+LQEFKP+GD+ S S Sbjct: 66 GQKKAYEAKVWVKPWMNFKELQEFKPIGDTPSHPS 100 >gb|AAN65082.1| cysteine proteinase inhibitor, putative 1 [Arabidopsis thaliana] Length = 201 Score = 63.2 bits (152), Expect = 7e-08 Identities = 29/40 (72%), Positives = 33/40 (82%), Gaps = 1/40 (2%) Frame = -1 Query: 244 GQKKIYEAKVWVKPWENFKQLQEFKPVGDSSS-TSSDA*C 128 GQKK+YEAKVWVKPW NFK+LQEFKP D+ + TSSD C Sbjct: 66 GQKKLYEAKVWVKPWLNFKELQEFKPASDAPAITSSDLGC 105 >ref|NP_566425.1| cysteine proteinase inhibitor 6 [Arabidopsis thaliana] gi|17473693|gb|AAL38303.1| cysteine proteinase inhibitor, putative 1 [Arabidopsis thaliana] gi|21554079|gb|AAM63160.1| cysteine proteinase inhibitor, putative [Arabidopsis thaliana] gi|332641681|gb|AEE75202.1| cysteine proteinase inhibitor 6 [Arabidopsis thaliana] Length = 201 Score = 63.2 bits (152), Expect = 7e-08 Identities = 29/40 (72%), Positives = 33/40 (82%), Gaps = 1/40 (2%) Frame = -1 Query: 244 GQKKIYEAKVWVKPWENFKQLQEFKPVGDSSS-TSSDA*C 128 GQKK+YEAKVWVKPW NFK+LQEFKP D+ + TSSD C Sbjct: 66 GQKKLYEAKVWVKPWLNFKELQEFKPASDAPAITSSDLGC 105 >gb|KHN37731.1| Cysteine proteinase inhibitor 12 [Glycine soja] Length = 245 Score = 62.8 bits (151), Expect = 9e-08 Identities = 28/37 (75%), Positives = 33/37 (89%), Gaps = 1/37 (2%) Frame = -1 Query: 244 GQKKIYEAKVWVKPWENFKQLQEFKPVGDSSS-TSSD 137 G+KK+YEAKVWVKPW NFK+LQEFKP GD+ S TS+D Sbjct: 110 GEKKLYEAKVWVKPWLNFKELQEFKPAGDAPSFTSAD 146 >ref|XP_010241469.1| PREDICTED: cysteine proteinase inhibitor 12-like [Nelumbo nucifera] Length = 186 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/36 (80%), Positives = 33/36 (91%), Gaps = 1/36 (2%) Frame = -1 Query: 241 QKKIYEAKVWVKPWENFKQLQEFKPVGDSSS-TSSD 137 +KKIYEAKVWVKPW NFK+LQEFKPVGD+ + TSSD Sbjct: 57 KKKIYEAKVWVKPWLNFKELQEFKPVGDAPTFTSSD 92 >gb|AEK84226.1| cysteine protease inhibitor [Cucurbita maxima] Length = 101 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 244 GQKKIYEAKVWVKPWENFKQLQEFKPVGDSSSTSS 140 GQKK+YEAK+WVK WENFKQLQEFK VGD S SS Sbjct: 66 GQKKVYEAKIWVKVWENFKQLQEFKLVGDGSVGSS 100 >gb|KHN11196.1| Cysteine proteinase inhibitor 12 [Glycine soja] Length = 245 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/37 (75%), Positives = 32/37 (86%), Gaps = 1/37 (2%) Frame = -1 Query: 244 GQKKIYEAKVWVKPWENFKQLQEFKPVGD-SSSTSSD 137 G+KK+YEAKVWVKPW NFK+LQEFKP GD S TS+D Sbjct: 110 GEKKLYEAKVWVKPWLNFKELQEFKPAGDVPSFTSAD 146 >ref|XP_010520100.1| PREDICTED: cysteine proteinase inhibitor 6 [Tarenaya hassleriana] Length = 201 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/37 (78%), Positives = 32/37 (86%), Gaps = 1/37 (2%) Frame = -1 Query: 244 GQKKIYEAKVWVKPWENFKQLQEFKPVGDSSS-TSSD 137 G+KK+YEAKVWVKPW NFK+LQEFK GDS S TSSD Sbjct: 66 GKKKLYEAKVWVKPWMNFKELQEFKHAGDSPSITSSD 102 >ref|NP_001237734.1| cysteine proteinase inhibitor precursor [Glycine max] gi|1944319|dbj|BAA19608.1| cysteine proteinase inhibitor [Glycine max] gi|1944342|dbj|BAA19610.1| cysteine proteinase inhibitor [Glycine max] Length = 245 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/37 (75%), Positives = 32/37 (86%), Gaps = 1/37 (2%) Frame = -1 Query: 244 GQKKIYEAKVWVKPWENFKQLQEFKPVGD-SSSTSSD 137 G+KK+YEAKVWVKPW NFK+LQEFKP GD S TS+D Sbjct: 110 GEKKLYEAKVWVKPWLNFKELQEFKPAGDVPSFTSAD 146 >gb|ACU24145.1| unknown [Glycine max] Length = 245 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/37 (75%), Positives = 32/37 (86%), Gaps = 1/37 (2%) Frame = -1 Query: 244 GQKKIYEAKVWVKPWENFKQLQEFKPVGD-SSSTSSD 137 G+KK+YEAKVWVKPW NFK+LQEFKP GD S TS+D Sbjct: 110 GEKKLYEAKVWVKPWLNFKELQEFKPAGDVPSFTSAD 146 >emb|CAD21441.1| putative cysteine proteinase inhibitor [Rumex obtusifolius] Length = 99 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -1 Query: 244 GQKKIYEAKVWVKPWENFKQLQEFKPVGDSSSTS 143 G+KK+YEAKVWVKPW NFKQ+QEFK +GD STS Sbjct: 66 GKKKVYEAKVWVKPWMNFKQVQEFKLLGDQGSTS 99 >gb|KJB68715.1| hypothetical protein B456_011G2218002 [Gossypium raimondii] Length = 211 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -1 Query: 244 GQKKIYEAKVWVKPWENFKQLQEFKPVGDSSSTSSDA*C 128 G+KK+YEAKVWVKPW NFK+LQEFK GD+ S++S C Sbjct: 103 GKKKLYEAKVWVKPWMNFKELQEFKHAGDADSSASFTAC 141