BLASTX nr result
ID: Cinnamomum24_contig00037130
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00037130 (292 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KEQ85288.1| UPF0041-domain-containing protein [Aureobasidium ... 91 4e-16 ref|XP_013426981.1| UPF0041-domain-containing protein [Aureobasi... 91 4e-16 gb|KEQ65787.1| UPF0041-domain-containing protein [Aureobasidium ... 91 4e-16 ref|XP_013339962.1| hypothetical protein AUEXF2481DRAFT_69802 [A... 90 6e-16 ref|XP_007920048.1| hypothetical protein MYCFIDRAFT_48731 [Pseud... 90 6e-16 gb|EME49296.1| hypothetical protein DOTSEDRAFT_68160 [Dothistrom... 88 2e-15 gb|EMF17900.1| UPF0041-domain-containing protein [Sphaerulina mu... 85 2e-14 gb|KJX97247.1| hypothetical protein TI39_contig520g00012 [Zymose... 84 4e-14 ref|XP_003857471.1| hypothetical protein MYCGRDRAFT_52717 [Zymos... 84 4e-14 dbj|GAM82801.1| hypothetical protein ANO11243_007870 [fungal sp.... 84 5e-14 ref|XP_007781740.1| hypothetical protein W97_05520 [Coniosporium... 82 1e-13 ref|XP_007678185.1| hypothetical protein BAUCODRAFT_73558 [Baudo... 81 3e-13 ref|XP_013264511.1| hypothetical protein A1O9_03493 [Exophiala a... 78 3e-12 gb|EKG17879.1| hypothetical protein MPH_04828 [Macrophomina phas... 77 4e-12 ref|XP_007692619.1| hypothetical protein COCMIDRAFT_30265 [Bipol... 76 1e-11 ref|XP_007706785.1| hypothetical protein COCCADRAFT_81721 [Bipol... 76 1e-11 ref|XP_007694580.1| hypothetical protein COCSADRAFT_155389 [Bipo... 76 1e-11 ref|XP_008021689.1| hypothetical protein SETTUDRAFT_125437 [Seto... 74 3e-11 ref|XP_013325020.1| UPF0041 domain protein [Rasamsonia emersonii... 74 4e-11 ref|XP_007587712.1| putative upf0041 domain protein [Neofusicocc... 74 5e-11 >gb|KEQ85288.1| UPF0041-domain-containing protein [Aureobasidium pullulans EXF-150] Length = 177 Score = 90.5 bits (223), Expect = 4e-16 Identities = 41/45 (91%), Positives = 44/45 (97%) Frame = -1 Query: 292 LIWTRWCFVIKPRNLFLASVNFLLFCVGATQVSRVLLYQQSLKGD 158 LIWTRWCFVIKPRNLFLASVNFLLFCVGATQVSR+LL+QQ+ KGD Sbjct: 99 LIWTRWCFVIKPRNLFLASVNFLLFCVGATQVSRILLWQQAQKGD 143 >ref|XP_013426981.1| UPF0041-domain-containing protein [Aureobasidium namibiae CBS 147.97] gi|662515201|gb|KEQ72767.1| UPF0041-domain-containing protein [Aureobasidium namibiae CBS 147.97] Length = 178 Score = 90.5 bits (223), Expect = 4e-16 Identities = 41/45 (91%), Positives = 44/45 (97%) Frame = -1 Query: 292 LIWTRWCFVIKPRNLFLASVNFLLFCVGATQVSRVLLYQQSLKGD 158 LIWTRWCFVIKPRNLFLASVNFLLFCVGATQVSR+LL+QQ+ KGD Sbjct: 100 LIWTRWCFVIKPRNLFLASVNFLLFCVGATQVSRILLWQQAQKGD 144 >gb|KEQ65787.1| UPF0041-domain-containing protein [Aureobasidium melanogenum CBS 110374] Length = 177 Score = 90.5 bits (223), Expect = 4e-16 Identities = 41/45 (91%), Positives = 44/45 (97%) Frame = -1 Query: 292 LIWTRWCFVIKPRNLFLASVNFLLFCVGATQVSRVLLYQQSLKGD 158 LIWTRWCFVIKPRNLFLASVNFLLFCVGATQVSR+LL+QQ+ KGD Sbjct: 99 LIWTRWCFVIKPRNLFLASVNFLLFCVGATQVSRILLWQQAQKGD 143 >ref|XP_013339962.1| hypothetical protein AUEXF2481DRAFT_69802 [Aureobasidium subglaciale EXF-2481] gi|662534147|gb|KEQ91473.1| hypothetical protein AUEXF2481DRAFT_69802 [Aureobasidium subglaciale EXF-2481] Length = 177 Score = 90.1 bits (222), Expect = 6e-16 Identities = 41/45 (91%), Positives = 43/45 (95%) Frame = -1 Query: 292 LIWTRWCFVIKPRNLFLASVNFLLFCVGATQVSRVLLYQQSLKGD 158 LIWTRWCFVIKPRNLFLASVNFLLFCVGATQ SR+LL+QQS KGD Sbjct: 99 LIWTRWCFVIKPRNLFLASVNFLLFCVGATQTSRILLWQQSQKGD 143 >ref|XP_007920048.1| hypothetical protein MYCFIDRAFT_48731 [Pseudocercospora fijiensis CIRAD86] gi|452989298|gb|EME89053.1| hypothetical protein MYCFIDRAFT_48731 [Pseudocercospora fijiensis CIRAD86] Length = 182 Score = 90.1 bits (222), Expect = 6e-16 Identities = 40/45 (88%), Positives = 45/45 (100%) Frame = -1 Query: 292 LIWTRWCFVIKPRNLFLASVNFLLFCVGATQVSRVLLYQQSLKGD 158 LIWTRWCFVIKP+NLFLASVNFLLFCVGATQV+RVL+YQ+SLKG+ Sbjct: 103 LIWTRWCFVIKPKNLFLASVNFLLFCVGATQVTRVLMYQKSLKGE 147 >gb|EME49296.1| hypothetical protein DOTSEDRAFT_68160 [Dothistroma septosporum NZE10] Length = 174 Score = 88.2 bits (217), Expect = 2e-15 Identities = 41/45 (91%), Positives = 42/45 (93%) Frame = -1 Query: 292 LIWTRWCFVIKPRNLFLASVNFLLFCVGATQVSRVLLYQQSLKGD 158 LIWTRWCFVIKPRNLFLASVNFLLFCVGATQVSRVL YQ SLK + Sbjct: 98 LIWTRWCFVIKPRNLFLASVNFLLFCVGATQVSRVLSYQSSLKNE 142 >gb|EMF17900.1| UPF0041-domain-containing protein [Sphaerulina musiva SO2202] Length = 180 Score = 85.1 bits (209), Expect = 2e-14 Identities = 37/45 (82%), Positives = 44/45 (97%) Frame = -1 Query: 292 LIWTRWCFVIKPRNLFLASVNFLLFCVGATQVSRVLLYQQSLKGD 158 LIWTRWCFVI+P+N+FLASVNFLLFCVGATQ +RVLLYQ+SL+G+ Sbjct: 101 LIWTRWCFVIRPQNMFLASVNFLLFCVGATQTTRVLLYQRSLEGN 145 >gb|KJX97247.1| hypothetical protein TI39_contig520g00012 [Zymoseptoria brevis] Length = 178 Score = 84.0 bits (206), Expect = 4e-14 Identities = 39/44 (88%), Positives = 39/44 (88%) Frame = -1 Query: 292 LIWTRWCFVIKPRNLFLASVNFLLFCVGATQVSRVLLYQQSLKG 161 LIWTRWCFVIKPRNLFLASVNFLLFCVGATQ RVL YQ S KG Sbjct: 104 LIWTRWCFVIKPRNLFLASVNFLLFCVGATQTGRVLSYQASQKG 147 >ref|XP_003857471.1| hypothetical protein MYCGRDRAFT_52717 [Zymoseptoria tritici IPO323] gi|339477356|gb|EGP92447.1| hypothetical protein MYCGRDRAFT_52717 [Zymoseptoria tritici IPO323] Length = 178 Score = 84.0 bits (206), Expect = 4e-14 Identities = 39/44 (88%), Positives = 39/44 (88%) Frame = -1 Query: 292 LIWTRWCFVIKPRNLFLASVNFLLFCVGATQVSRVLLYQQSLKG 161 LIWTRWCFVIKPRNLFLASVNFLLFCVGATQ RVL YQ S KG Sbjct: 104 LIWTRWCFVIKPRNLFLASVNFLLFCVGATQTGRVLSYQASQKG 147 >dbj|GAM82801.1| hypothetical protein ANO11243_007870 [fungal sp. No.11243] Length = 140 Score = 83.6 bits (205), Expect = 5e-14 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -1 Query: 289 IWTRWCFVIKPRNLFLASVNFLLFCVGATQVSRVLLYQQSLKGD 158 IWTRWCFVIKPRNLFLASVNFLLFCVGATQVSR L+YQ+SL + Sbjct: 65 IWTRWCFVIKPRNLFLASVNFLLFCVGATQVSRGLMYQRSLTAE 108 >ref|XP_007781740.1| hypothetical protein W97_05520 [Coniosporium apollinis CBS 100218] gi|494829842|gb|EON66423.1| hypothetical protein W97_05520 [Coniosporium apollinis CBS 100218] Length = 179 Score = 82.4 bits (202), Expect = 1e-13 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = -1 Query: 289 IWTRWCFVIKPRNLFLASVNFLLFCVGATQVSRVLLYQQSLK 164 IWTRWCFVIKPRN+FLASVNFLLFCVGATQV R+L Y QS+K Sbjct: 99 IWTRWCFVIKPRNIFLASVNFLLFCVGATQVGRILSYHQSIK 140 >ref|XP_007678185.1| hypothetical protein BAUCODRAFT_73558 [Baudoinia panamericana UAMH 10762] gi|449298527|gb|EMC94542.1| hypothetical protein BAUCODRAFT_73558 [Baudoinia panamericana UAMH 10762] Length = 175 Score = 80.9 bits (198), Expect = 3e-13 Identities = 37/43 (86%), Positives = 39/43 (90%) Frame = -1 Query: 289 IWTRWCFVIKPRNLFLASVNFLLFCVGATQVSRVLLYQQSLKG 161 IWTRWCFVIKPRNLFLASVN LL CVG TQV+R L+YQQSLKG Sbjct: 100 IWTRWCFVIKPRNLFLASVNALLACVGLTQVTRALMYQQSLKG 142 >ref|XP_013264511.1| hypothetical protein A1O9_03493 [Exophiala aquamarina CBS 119918] gi|656916342|gb|KEF61921.1| hypothetical protein A1O9_03493 [Exophiala aquamarina CBS 119918] Length = 105 Score = 77.8 bits (190), Expect = 3e-12 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = -1 Query: 289 IWTRWCFVIKPRNLFLASVNFLLFCVGATQVSRVLLYQQSLKG 161 IWTRWCF+IKP+N+ LA+VNF LF VG TQVSR+LLYQQS+KG Sbjct: 34 IWTRWCFIIKPQNMLLAAVNFCLFLVGTTQVSRILLYQQSIKG 76 >gb|EKG17879.1| hypothetical protein MPH_04828 [Macrophomina phaseolina MS6] Length = 86 Score = 77.4 bits (189), Expect = 4e-12 Identities = 33/44 (75%), Positives = 38/44 (86%) Frame = -1 Query: 289 IWTRWCFVIKPRNLFLASVNFLLFCVGATQVSRVLLYQQSLKGD 158 IWTRWCF+I+PRNLFLA+VNF L CVG Q SR+LLY+ SLKGD Sbjct: 9 IWTRWCFIIRPRNLFLAAVNFFLGCVGLIQTSRILLYRSSLKGD 52 >ref|XP_007692619.1| hypothetical protein COCMIDRAFT_30265 [Bipolaris oryzae ATCC 44560] gi|576927168|gb|EUC40870.1| hypothetical protein COCMIDRAFT_30265 [Bipolaris oryzae ATCC 44560] Length = 157 Score = 75.9 bits (185), Expect = 1e-11 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = -1 Query: 289 IWTRWCFVIKPRNLFLASVNFLLFCVGATQVSRVLLYQQSLK 164 IWTRWCFVI+P+N+ LA+VNFL+FCVGATQV R+ LY QSLK Sbjct: 90 IWTRWCFVIRPKNIALAAVNFLVFCVGATQVGRIYLYNQSLK 131 >ref|XP_007706785.1| hypothetical protein COCCADRAFT_81721 [Bipolaris zeicola 26-R-13] gi|928532128|ref|XP_014084861.1| hypothetical protein COCC4DRAFT_122790 [Bipolaris maydis ATCC 48331] gi|953434979|ref|XP_014559561.1| hypothetical protein COCVIDRAFT_91534 [Bipolaris victoriae FI3] gi|452003635|gb|EMD96092.1| hypothetical protein COCHEDRAFT_1166949 [Bipolaris maydis C5] gi|477593883|gb|ENI10952.1| hypothetical protein COCC4DRAFT_122790 [Bipolaris maydis ATCC 48331] gi|576924890|gb|EUC38997.1| hypothetical protein COCCADRAFT_81721 [Bipolaris zeicola 26-R-13] gi|578492586|gb|EUN29985.1| hypothetical protein COCVIDRAFT_91534 [Bipolaris victoriae FI3] Length = 156 Score = 75.9 bits (185), Expect = 1e-11 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = -1 Query: 289 IWTRWCFVIKPRNLFLASVNFLLFCVGATQVSRVLLYQQSLK 164 IWTRWCFVI+P+N+ LA+VNFL+FCVGATQV R+ LY QSLK Sbjct: 90 IWTRWCFVIRPKNIALAAVNFLVFCVGATQVGRIYLYNQSLK 131 >ref|XP_007694580.1| hypothetical protein COCSADRAFT_155389 [Bipolaris sorokiniana ND90Pr] gi|451855888|gb|EMD69179.1| hypothetical protein COCSADRAFT_155389 [Bipolaris sorokiniana ND90Pr] Length = 156 Score = 75.9 bits (185), Expect = 1e-11 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = -1 Query: 289 IWTRWCFVIKPRNLFLASVNFLLFCVGATQVSRVLLYQQSLK 164 IWTRWCFVI+P+N+ LA+VNFL+FCVGATQV R+ LY QSLK Sbjct: 90 IWTRWCFVIRPKNIALAAVNFLVFCVGATQVGRIYLYNQSLK 131 >ref|XP_008021689.1| hypothetical protein SETTUDRAFT_125437 [Setosphaeria turcica Et28A] gi|482814338|gb|EOA91016.1| hypothetical protein SETTUDRAFT_125437 [Setosphaeria turcica Et28A] Length = 156 Score = 74.3 bits (181), Expect = 3e-11 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = -1 Query: 289 IWTRWCFVIKPRNLFLASVNFLLFCVGATQVSRVLLYQQSLK 164 IWTRWCFVI+P+N+ LA+VNFL+FCVG TQV R+ LY QSLK Sbjct: 90 IWTRWCFVIRPKNIALAAVNFLVFCVGGTQVGRIYLYNQSLK 131 >ref|XP_013325020.1| UPF0041 domain protein [Rasamsonia emersonii CBS 393.64] gi|802088411|gb|KKA18408.1| UPF0041 domain protein [Rasamsonia emersonii CBS 393.64] Length = 165 Score = 73.9 bits (180), Expect = 4e-11 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = -1 Query: 289 IWTRWCFVIKPRNLFLASVNFLLFCVGATQVSRVLLYQQSLKG 161 IWTRWCF+IKPRNL LA+VNF L CVG QV+R+ LY++SLKG Sbjct: 103 IWTRWCFIIKPRNLLLAAVNFFLGCVGVVQVTRIFLYRRSLKG 145 >ref|XP_007587712.1| putative upf0041 domain protein [Neofusicoccum parvum UCRNP2] gi|485918063|gb|EOD44807.1| putative upf0041 domain protein [Neofusicoccum parvum UCRNP2] Length = 176 Score = 73.6 bits (179), Expect = 5e-11 Identities = 31/44 (70%), Positives = 37/44 (84%) Frame = -1 Query: 289 IWTRWCFVIKPRNLFLASVNFLLFCVGATQVSRVLLYQQSLKGD 158 IWTRWCF+IKPRNLFLA+VNF L CVG Q SR+L+++ S KGD Sbjct: 99 IWTRWCFIIKPRNLFLAAVNFFLGCVGLIQTSRILMWRSSQKGD 142