BLASTX nr result
ID: Cinnamomum24_contig00036493
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00036493 (227 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007928996.1| hypothetical protein MYCFIDRAFT_211894 [Pseu... 64 6e-08 gb|EMF10238.1| hypothetical protein SEPMUDRAFT_151231 [Sphaeruli... 61 3e-07 gb|EME39381.1| hypothetical protein DOTSEDRAFT_75172 [Dothistrom... 61 3e-07 ref|XP_007681539.1| hypothetical protein BAUCODRAFT_80598 [Baudo... 61 4e-07 ref|XP_007583677.1| hypothetical protein UCRNP2_4394 [Neofusicoc... 59 2e-06 ref|XP_007780239.1| hypothetical protein W97_04156 [Coniosporium... 58 2e-06 gb|EKG14955.1| hypothetical protein MPH_07855 [Macrophomina phas... 57 4e-06 >ref|XP_007928996.1| hypothetical protein MYCFIDRAFT_211894 [Pseudocercospora fijiensis CIRAD86] gi|452980119|gb|EME79880.1| hypothetical protein MYCFIDRAFT_211894 [Pseudocercospora fijiensis CIRAD86] Length = 403 Score = 63.5 bits (153), Expect = 6e-08 Identities = 31/39 (79%), Positives = 33/39 (84%), Gaps = 1/39 (2%) Frame = -2 Query: 226 DDDEGGDLFALPMSPRSPEM-TKSPFSFAAQDTRRYLSQ 113 DDD+ DLFALPMSPRSPEM TKSPFSF AQDT RYL + Sbjct: 360 DDDKADDLFALPMSPRSPEMGTKSPFSFTAQDTMRYLKE 398 >gb|EMF10238.1| hypothetical protein SEPMUDRAFT_151231 [Sphaerulina musiva SO2202] Length = 459 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = -2 Query: 226 DDDEGGDLFALPMSPRSPEMTKSPFSFAAQDTRRYLSQ 113 D + DLFALPMSPRSPEMTKSPFSFA QDT +YL + Sbjct: 418 DHHDEDDLFALPMSPRSPEMTKSPFSFAVQDTMKYLKE 455 >gb|EME39381.1| hypothetical protein DOTSEDRAFT_75172 [Dothistroma septosporum NZE10] Length = 388 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -2 Query: 226 DDDEGGDLFALPMSPRSPEMTKSPFSFAAQDTRRYL 119 DDD+ DLFALPMSPRSP+M+KSPFSFAAQDT RYL Sbjct: 350 DDDD--DLFALPMSPRSPDMSKSPFSFAAQDTVRYL 383 >ref|XP_007681539.1| hypothetical protein BAUCODRAFT_80598 [Baudoinia panamericana UAMH 10762] gi|449295206|gb|EMC91228.1| hypothetical protein BAUCODRAFT_80598 [Baudoinia panamericana UAMH 10762] Length = 343 Score = 60.8 bits (146), Expect = 4e-07 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = -2 Query: 226 DDDEGGDLFALPMSPRSPEMTKSPFSFAAQDTRRYLSQ 113 DD++ DLFALPMSPRSP+MTKSPFSF + DT +Y+S+ Sbjct: 305 DDEQEDDLFALPMSPRSPDMTKSPFSFGSADTMKYMSR 342 >ref|XP_007583677.1| hypothetical protein UCRNP2_4394 [Neofusicoccum parvum UCRNP2] gi|485923840|gb|EOD48842.1| hypothetical protein UCRNP2_4394 [Neofusicoccum parvum UCRNP2] Length = 402 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -2 Query: 226 DDDEGGDLFALPMSPRSPEMTKSPFSFAAQDTRRYL 119 DDD DLFALP+SPRSP+M+KSPFSFAA DT +Y+ Sbjct: 362 DDDHEDDLFALPISPRSPDMSKSPFSFAASDTVKYV 397 >ref|XP_007780239.1| hypothetical protein W97_04156 [Coniosporium apollinis CBS 100218] gi|494828050|gb|EON64922.1| hypothetical protein W97_04156 [Coniosporium apollinis CBS 100218] Length = 390 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/35 (71%), Positives = 32/35 (91%) Frame = -2 Query: 223 DDEGGDLFALPMSPRSPEMTKSPFSFAAQDTRRYL 119 D++ DLFALP+SPRSP+M+KSPFSFAA DT++YL Sbjct: 350 DEKEDDLFALPISPRSPDMSKSPFSFAASDTKKYL 384 >gb|EKG14955.1| hypothetical protein MPH_07855 [Macrophomina phaseolina MS6] Length = 389 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -2 Query: 226 DDDEGGDLFALPMSPRSPEMTKSPFSFAAQDTRRYL 119 +DD DLFALP+SPRSP+M+KSPFSFAA DT +Y+ Sbjct: 348 EDDREDDLFALPISPRSPDMSKSPFSFAASDTLKYV 383