BLASTX nr result
ID: Cinnamomum24_contig00036469
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00036469 (234 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJX99706.1| putative gpi transamidase component pig-u protein... 64 3e-08 ref|XP_003852698.1| hypothetical protein MYCGRDRAFT_71895 [Zymos... 63 8e-08 ref|XP_007678214.1| hypothetical protein BAUCODRAFT_73965 [Baudo... 59 1e-06 gb|EME49171.1| hypothetical protein DOTSEDRAFT_40413 [Dothistrom... 58 2e-06 >gb|KJX99706.1| putative gpi transamidase component pig-u protein [Zymoseptoria brevis] Length = 456 Score = 64.3 bits (155), Expect = 3e-08 Identities = 33/76 (43%), Positives = 50/76 (65%) Frame = -2 Query: 233 YDQICRRQTHSGTKSSNANHISPGGSKSKVAIDQRSLPAALPFTLLFGGTFVTAVALLLS 54 YD+IC R+ S +S + +P +K+A DQRS+P LP L+ +F+ + A LLS Sbjct: 210 YDRICFRRQQSKPESGSQPTKAPA---AKIAHDQRSVPRPLPVALVLLASFLISTAFLLS 266 Query: 53 LSRVILPSWSFLASVY 6 LSR++LPSW+F+ +VY Sbjct: 267 LSRLLLPSWNFIPAVY 282 >ref|XP_003852698.1| hypothetical protein MYCGRDRAFT_71895 [Zymoseptoria tritici IPO323] gi|339472579|gb|EGP87674.1| hypothetical protein MYCGRDRAFT_71895 [Zymoseptoria tritici IPO323] Length = 456 Score = 63.2 bits (152), Expect = 8e-08 Identities = 33/76 (43%), Positives = 49/76 (64%) Frame = -2 Query: 233 YDQICRRQTHSGTKSSNANHISPGGSKSKVAIDQRSLPAALPFTLLFGGTFVTAVALLLS 54 YD+IC R+ S +S + +P K+A DQRS+P LP L+ +F+ + A LLS Sbjct: 210 YDRICFRRQQSKPESDSQPAKAPA---VKIAHDQRSVPRPLPVALVLLASFLLSTAFLLS 266 Query: 53 LSRVILPSWSFLASVY 6 LSR++LPSW+F+ +VY Sbjct: 267 LSRLLLPSWNFIPAVY 282 >ref|XP_007678214.1| hypothetical protein BAUCODRAFT_73965 [Baudoinia panamericana UAMH 10762] gi|449298875|gb|EMC94890.1| hypothetical protein BAUCODRAFT_73965 [Baudoinia panamericana UAMH 10762] Length = 458 Score = 58.9 bits (141), Expect = 1e-06 Identities = 33/76 (43%), Positives = 44/76 (57%) Frame = -2 Query: 233 YDQICRRQTHSGTKSSNANHISPGGSKSKVAIDQRSLPAALPFTLLFGGTFVTAVALLLS 54 YD++C Q +SN I S +K+A DQR L TL F G ++ LLL+ Sbjct: 210 YDRLCLLQHQGRDATSNGAAIEKPTS-TKIAHDQRLQARPLELTLRFSGIYLATFLLLLT 268 Query: 53 LSRVILPSWSFLASVY 6 LSR++LPSWSF+ SVY Sbjct: 269 LSRLLLPSWSFMPSVY 284 >gb|EME49171.1| hypothetical protein DOTSEDRAFT_40413 [Dothistroma septosporum NZE10] Length = 446 Score = 58.2 bits (139), Expect = 2e-06 Identities = 33/68 (48%), Positives = 40/68 (58%) Frame = -2 Query: 209 THSGTKSSNANHISPGGSKSKVAIDQRSLPAALPFTLLFGGTFVTAVALLLSLSRVILPS 30 TH T S H + G V DQRSLPA LPF + F ++ALLL LSR++LPS Sbjct: 209 THK-TASETQKHTTQGVD---VTQDQRSLPARLPFATMVIAAFAVSLALLLGLSRLLLPS 264 Query: 29 WSFLASVY 6 W F+ SVY Sbjct: 265 WYFIVSVY 272