BLASTX nr result
ID: Cinnamomum24_contig00036451
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00036451 (385 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME48222.1| hypothetical protein DOTSEDRAFT_69987 [Dothistrom... 75 1e-11 ref|XP_007923626.1| hypothetical protein MYCFIDRAFT_151331 [Pseu... 75 2e-11 gb|EMF14889.1| auxin efflux carrier [Sphaerulina musiva SO2202] 75 3e-11 gb|KJY01609.1| auxin efflux carrier superfamily like protein [Zy... 73 7e-11 ref|XP_003848847.1| transporter auxin efflux carrier-like protei... 73 7e-11 ref|XP_007680390.1| hypothetical protein BAUCODRAFT_38381 [Baudo... 70 8e-10 dbj|GAD97899.1| Auxin Efflux Carrier superfamily [Byssochlamys s... 66 1e-08 ref|XP_002478349.1| Auxin Efflux Carrier superfamily [Talaromyce... 65 2e-08 gb|KEQ64220.1| auxin efflux carrier [Aureobasidium melanogenum C... 65 3e-08 ref|XP_013330740.1| Auxin Efflux Carrier superfamily [Rasamsonia... 64 4e-08 dbj|GAM42756.1| hypothetical protein TCE0_044r17019 [Talaromyces... 64 4e-08 ref|XP_002146058.1| Auxin Efflux Carrier superfamily [Talaromyce... 64 4e-08 ref|XP_002146057.1| Auxin Efflux Carrier superfamily [Talaromyce... 64 4e-08 ref|XP_003069027.1| Auxin Efflux Carrier family protein [Coccidi... 64 4e-08 ref|XP_001243642.1| auxin Efflux Carrier superfamily protein [Co... 64 4e-08 ref|XP_007582075.1| putative auxin efflux carrier superfamily pr... 63 8e-08 gb|EKG12526.1| Auxin efflux carrier [Macrophomina phaseolina MS6] 63 8e-08 gb|KNG44398.1| auxin efflux carrier superfamily protein [Stemphy... 63 1e-07 emb|CRG89471.1| hypothetical protein PISL3812_06507 [Talaromyces... 63 1e-07 ref|XP_003305483.1| hypothetical protein PTT_18337 [Pyrenophora ... 63 1e-07 >gb|EME48222.1| hypothetical protein DOTSEDRAFT_69987 [Dothistroma septosporum NZE10] Length = 584 Score = 75.5 bits (184), Expect = 1e-11 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +1 Query: 1 GAPSALQLAQICQINNVFMGAMSSLLVASYVVVIFPST 114 GAPSALQLAQICQINNVFMGAMSSLLVASYVVVIFPST Sbjct: 531 GAPSALQLAQICQINNVFMGAMSSLLVASYVVVIFPST 568 >ref|XP_007923626.1| hypothetical protein MYCFIDRAFT_151331 [Pseudocercospora fijiensis CIRAD86] gi|452986543|gb|EME86299.1| hypothetical protein MYCFIDRAFT_151331 [Pseudocercospora fijiensis CIRAD86] Length = 572 Score = 75.1 bits (183), Expect = 2e-11 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +1 Query: 1 GAPSALQLAQICQINNVFMGAMSSLLVASYVVVIFPST 114 GAPSALQLAQICQINN+FMGAMSSLLVASYVVVIFPST Sbjct: 519 GAPSALQLAQICQINNIFMGAMSSLLVASYVVVIFPST 556 >gb|EMF14889.1| auxin efflux carrier [Sphaerulina musiva SO2202] Length = 602 Score = 74.7 bits (182), Expect = 3e-11 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +1 Query: 1 GAPSALQLAQICQINNVFMGAMSSLLVASYVVVIFPST 114 GAPSALQLAQICQ+NNVFMGAMSSLLVASYVVVIFPST Sbjct: 548 GAPSALQLAQICQLNNVFMGAMSSLLVASYVVVIFPST 585 >gb|KJY01609.1| auxin efflux carrier superfamily like protein [Zymoseptoria brevis] Length = 592 Score = 73.2 bits (178), Expect = 7e-11 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +1 Query: 1 GAPSALQLAQICQINNVFMGAMSSLLVASYVVVIFPST 114 GAPSALQLAQICQIN VFMGAMSSLLVASYVVVIFPST Sbjct: 539 GAPSALQLAQICQINGVFMGAMSSLLVASYVVVIFPST 576 >ref|XP_003848847.1| transporter auxin efflux carrier-like protein [Zymoseptoria tritici IPO323] gi|339468723|gb|EGP83823.1| transporter auxin efflux carrier-like protein [Zymoseptoria tritici IPO323] Length = 575 Score = 73.2 bits (178), Expect = 7e-11 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +1 Query: 1 GAPSALQLAQICQINNVFMGAMSSLLVASYVVVIFPST 114 GAPSALQLAQICQIN VFMGAMSSLLVASYVVVIFPST Sbjct: 522 GAPSALQLAQICQINGVFMGAMSSLLVASYVVVIFPST 559 >ref|XP_007680390.1| hypothetical protein BAUCODRAFT_38381 [Baudoinia panamericana UAMH 10762] gi|449296313|gb|EMC92333.1| hypothetical protein BAUCODRAFT_38381 [Baudoinia panamericana UAMH 10762] Length = 610 Score = 69.7 bits (169), Expect = 8e-10 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +1 Query: 1 GAPSALQLAQICQINNVFMGAMSSLLVASYVVVIFPST 114 GAPSALQLAQICQ+N VFMGAMSSLL ASYVV IFPST Sbjct: 558 GAPSALQLAQICQVNGVFMGAMSSLLTASYVVAIFPST 595 >dbj|GAD97899.1| Auxin Efflux Carrier superfamily [Byssochlamys spectabilis No. 5] Length = 583 Score = 65.9 bits (159), Expect = 1e-08 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = +1 Query: 1 GAPSALQLAQICQINNVFMGAMSSLLVASYVVVIFPST 114 GAPSALQLAQICQINNVFMGAMSS+L SYVV I PST Sbjct: 529 GAPSALQLAQICQINNVFMGAMSSILFQSYVVWILPST 566 >ref|XP_002478349.1| Auxin Efflux Carrier superfamily [Talaromyces stipitatus ATCC 10500] gi|218721968|gb|EED21386.1| Auxin Efflux Carrier superfamily [Talaromyces stipitatus ATCC 10500] Length = 594 Score = 65.1 bits (157), Expect = 2e-08 Identities = 33/38 (86%), Positives = 33/38 (86%) Frame = +1 Query: 1 GAPSALQLAQICQINNVFMGAMSSLLVASYVVVIFPST 114 GAPSALQLAQICQINNVFMGAMS LL SYVV I PST Sbjct: 539 GAPSALQLAQICQINNVFMGAMSKLLFQSYVVWILPST 576 >gb|KEQ64220.1| auxin efflux carrier [Aureobasidium melanogenum CBS 110374] Length = 578 Score = 64.7 bits (156), Expect = 3e-08 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +1 Query: 1 GAPSALQLAQICQINNVFMGAMSSLLVASYVVVIFPST 114 GAPSALQLAQICQ+NNVFMG MS LLV SYVV I PST Sbjct: 526 GAPSALQLAQICQLNNVFMGVMSKLLVQSYVVWILPST 563 >ref|XP_013330740.1| Auxin Efflux Carrier superfamily [Rasamsonia emersonii CBS 393.64] gi|802094516|gb|KKA24128.1| Auxin Efflux Carrier superfamily [Rasamsonia emersonii CBS 393.64] Length = 599 Score = 63.9 bits (154), Expect = 4e-08 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +1 Query: 1 GAPSALQLAQICQINNVFMGAMSSLLVASYVVVIFPST 114 GAPSALQLAQICQINNV+MGAMS LL SYVV I PST Sbjct: 545 GAPSALQLAQICQINNVYMGAMSQLLFQSYVVWILPST 582 >dbj|GAM42756.1| hypothetical protein TCE0_044r17019 [Talaromyces cellulolyticus] Length = 783 Score = 63.9 bits (154), Expect = 4e-08 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +1 Query: 1 GAPSALQLAQICQINNVFMGAMSSLLVASYVVVIFPST 114 GAPSALQLAQICQINNV+MGAMS LL SYVV I PST Sbjct: 728 GAPSALQLAQICQINNVYMGAMSKLLFQSYVVWILPST 765 >ref|XP_002146058.1| Auxin Efflux Carrier superfamily [Talaromyces marneffei ATCC 18224] gi|210071422|gb|EEA25511.1| Auxin Efflux Carrier superfamily [Talaromyces marneffei ATCC 18224] Length = 525 Score = 63.9 bits (154), Expect = 4e-08 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +1 Query: 1 GAPSALQLAQICQINNVFMGAMSSLLVASYVVVIFPST 114 GAPSALQLAQICQINNV+MGAMS LL SYVV I PST Sbjct: 470 GAPSALQLAQICQINNVYMGAMSKLLFQSYVVWILPST 507 >ref|XP_002146057.1| Auxin Efflux Carrier superfamily [Talaromyces marneffei ATCC 18224] gi|210071421|gb|EEA25510.1| Auxin Efflux Carrier superfamily [Talaromyces marneffei ATCC 18224] gi|679991177|gb|KFX43967.1| putative transporter [Talaromyces marneffei PM1] Length = 594 Score = 63.9 bits (154), Expect = 4e-08 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +1 Query: 1 GAPSALQLAQICQINNVFMGAMSSLLVASYVVVIFPST 114 GAPSALQLAQICQINNV+MGAMS LL SYVV I PST Sbjct: 539 GAPSALQLAQICQINNVYMGAMSKLLFQSYVVWILPST 576 >ref|XP_003069027.1| Auxin Efflux Carrier family protein [Coccidioides posadasii C735 delta SOWgp] gi|240108708|gb|EER26882.1| Auxin Efflux Carrier family protein [Coccidioides posadasii C735 delta SOWgp] gi|320036813|gb|EFW18751.1| hypothetical protein CPSG_04297 [Coccidioides posadasii str. Silveira] gi|855538301|gb|KMM72389.1| auxin family [Coccidioides posadasii RMSCC 3488] Length = 582 Score = 63.9 bits (154), Expect = 4e-08 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +1 Query: 1 GAPSALQLAQICQINNVFMGAMSSLLVASYVVVIFPST 114 GAPSALQLAQICQINNV+MGAMS LL SYVV I PST Sbjct: 528 GAPSALQLAQICQINNVYMGAMSKLLFQSYVVWILPST 565 >ref|XP_001243642.1| auxin Efflux Carrier superfamily protein [Coccidioides immitis RS] gi|90302428|gb|EAS32059.1| auxin Efflux Carrier superfamily protein [Coccidioides immitis RS] gi|859413655|gb|KMP07247.1| auxin family protein [Coccidioides immitis RMSCC 2394] gi|875284291|gb|KMU78018.1| auxin family protein [Coccidioides immitis RMSCC 3703] gi|875634601|gb|KMU82322.1| auxin family protein [Coccidioides immitis H538.4] Length = 582 Score = 63.9 bits (154), Expect = 4e-08 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +1 Query: 1 GAPSALQLAQICQINNVFMGAMSSLLVASYVVVIFPST 114 GAPSALQLAQICQINNV+MGAMS LL SYVV I PST Sbjct: 528 GAPSALQLAQICQINNVYMGAMSKLLFQSYVVWILPST 565 >ref|XP_007582075.1| putative auxin efflux carrier superfamily protein [Neofusicoccum parvum UCRNP2] gi|485926063|gb|EOD50454.1| putative auxin efflux carrier superfamily protein [Neofusicoccum parvum UCRNP2] Length = 593 Score = 63.2 bits (152), Expect = 8e-08 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +1 Query: 1 GAPSALQLAQICQINNVFMGAMSSLLVASYVVVIFPST 114 GAPSALQLAQICQ+NNV+MGAMS LL SYVV I PST Sbjct: 534 GAPSALQLAQICQLNNVYMGAMSKLLFQSYVVWILPST 571 >gb|EKG12526.1| Auxin efflux carrier [Macrophomina phaseolina MS6] Length = 562 Score = 63.2 bits (152), Expect = 8e-08 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +1 Query: 1 GAPSALQLAQICQINNVFMGAMSSLLVASYVVVIFPST 114 GAPSALQLAQICQ+NNV+MGAMS LL SYVV I PST Sbjct: 504 GAPSALQLAQICQLNNVYMGAMSKLLFQSYVVWILPST 541 >gb|KNG44398.1| auxin efflux carrier superfamily protein [Stemphylium lycopersici] Length = 576 Score = 62.8 bits (151), Expect = 1e-07 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +1 Query: 1 GAPSALQLAQICQINNVFMGAMSSLLVASYVVVIFPST 114 GAPSALQLAQICQINNV+MGAMS +L SYVV I PST Sbjct: 524 GAPSALQLAQICQINNVYMGAMSRILFQSYVVWILPST 561 >emb|CRG89471.1| hypothetical protein PISL3812_06507 [Talaromyces islandicus] Length = 592 Score = 62.8 bits (151), Expect = 1e-07 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +1 Query: 1 GAPSALQLAQICQINNVFMGAMSSLLVASYVVVIFPST 114 GAPSALQLAQICQ+NNV+MGAMS LL SYVV I PST Sbjct: 537 GAPSALQLAQICQLNNVYMGAMSRLLFQSYVVWILPST 574 >ref|XP_003305483.1| hypothetical protein PTT_18337 [Pyrenophora teres f. teres 0-1] gi|311317465|gb|EFQ86411.1| hypothetical protein PTT_18337 [Pyrenophora teres f. teres 0-1] Length = 574 Score = 62.8 bits (151), Expect = 1e-07 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +1 Query: 1 GAPSALQLAQICQINNVFMGAMSSLLVASYVVVIFPST 114 GAPSALQLAQICQINNV+MGAMS +L SYVV I PST Sbjct: 522 GAPSALQLAQICQINNVYMGAMSRILFQSYVVWILPST 559