BLASTX nr result
ID: Cinnamomum24_contig00036351
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00036351 (251 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME43398.1| hypothetical protein DOTSEDRAFT_72709 [Dothistrom... 89 1e-15 gb|KKY18617.1| putative 60s ribosomal protein l25 [Diplodia seri... 86 8e-15 ref|XP_003850458.1| 60S ribosomal protein L25 [Zymoseptoria trit... 85 2e-14 ref|XP_007588330.1| putative 60s ribosomal protein l25 protein [... 84 3e-14 gb|EMF12092.1| 60S ribosomal protein L23 [Sphaerulina musiva SO2... 84 5e-14 ref|XP_007675420.1| hypothetical protein BAUCODRAFT_68260, parti... 84 5e-14 ref|XP_007927050.1| hypothetical protein MYCFIDRAFT_52665 [Pseud... 82 2e-13 ref|XP_008084021.1| Ribosomal proteins S24e, L23 and L15e [Glare... 81 3e-13 ref|XP_001273898.1| 60S ribosomal protein L25 [Aspergillus clava... 79 1e-12 ref|XP_008717630.1| hypothetical protein HMPREF1541_05067 [Cyphe... 79 2e-12 ref|XP_007294929.1| 60S ribosomal protein L25 [Marssonina brunne... 79 2e-12 ref|XP_963077.1| 60S ribosomal protein L25 [Neurospora crassa OR... 77 5e-12 ref|XP_006692828.1| 60S ribosomal protein L25-like protein [Chae... 77 5e-12 ref|XP_003345807.1| 60S ribosomal protein L25 [Sordaria macrospo... 77 7e-12 ref|XP_007912405.1| putative 60s ribosomal protein l25 protein [... 77 7e-12 dbj|GAQ09041.1| 60S ribosomal protein L25 [Aspergillus lentulus] 76 1e-11 dbj|GAO82200.1| 60S ribosomal protein L25 [Neosartorya udagawae] 76 1e-11 gb|KMK59218.1| 60S ribosomal protein L23 [Aspergillus fumigatus Z5] 76 1e-11 gb|KKK26734.1| 60S ribosomal protein [Aspergillus rambellii] 76 1e-11 gb|KKK15310.1| 60S ribosomal protein, partial [Aspergillus ochra... 76 1e-11 >gb|EME43398.1| hypothetical protein DOTSEDRAFT_72709 [Dothistroma septosporum NZE10] Length = 160 Score = 89.4 bits (220), Expect = 1e-15 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = -1 Query: 140 TLRGVNSHKTHKVRKNTTFHLPKTLQLSRAPKYPRRSVPHQPRLDA 3 TL+GVNSHKTHKVRK+TTFHLPKTL LSRAPKYPRRS+P +PRLDA Sbjct: 31 TLKGVNSHKTHKVRKSTTFHLPKTLTLSRAPKYPRRSIPREPRLDA 76 >gb|KKY18617.1| putative 60s ribosomal protein l25 [Diplodia seriata] Length = 150 Score = 86.3 bits (212), Expect = 8e-15 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = -1 Query: 140 TLRGVNSHKTHKVRKNTTFHLPKTLQLSRAPKYPRRSVPHQPRLDA 3 TL+GVNSHK KVRK+TTFH PKTLQLSRAPKYPR S+PHQPRLDA Sbjct: 21 TLKGVNSHKVRKVRKSTTFHRPKTLQLSRAPKYPRTSIPHQPRLDA 66 >ref|XP_003850458.1| 60S ribosomal protein L25 [Zymoseptoria tritici IPO323] gi|339470336|gb|EGP85434.1| hypothetical protein MYCGRDRAFT_105388 [Zymoseptoria tritici IPO323] gi|796708960|gb|KJY00078.1| 60s ribosomal protein l25 [Zymoseptoria brevis] Length = 155 Score = 85.1 bits (209), Expect = 2e-14 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -1 Query: 140 TLRGVNSHKTHKVRKNTTFHLPKTLQLSRAPKYPRRSVPHQPRLDA 3 TLRGVNSHKT KVRK+T+FHLPKTL LSRAPKYPR+SVP QPRLDA Sbjct: 26 TLRGVNSHKTTKVRKSTSFHLPKTLTLSRAPKYPRKSVPSQPRLDA 71 >ref|XP_007588330.1| putative 60s ribosomal protein l25 protein [Neofusicoccum parvum UCRNP2] gi|485917148|gb|EOD44201.1| putative 60s ribosomal protein l25 protein [Neofusicoccum parvum UCRNP2] Length = 150 Score = 84.3 bits (207), Expect = 3e-14 Identities = 37/46 (80%), Positives = 42/46 (91%) Frame = -1 Query: 140 TLRGVNSHKTHKVRKNTTFHLPKTLQLSRAPKYPRRSVPHQPRLDA 3 TL+GVNSHK KVR +TTFH PKTLQLSRAPKYPR+S+PH+PRLDA Sbjct: 21 TLKGVNSHKVRKVRNSTTFHRPKTLQLSRAPKYPRKSIPHEPRLDA 66 >gb|EMF12092.1| 60S ribosomal protein L23 [Sphaerulina musiva SO2202] Length = 154 Score = 83.6 bits (205), Expect = 5e-14 Identities = 39/46 (84%), Positives = 41/46 (89%) Frame = -1 Query: 140 TLRGVNSHKTHKVRKNTTFHLPKTLQLSRAPKYPRRSVPHQPRLDA 3 TLRGVNSHK KVRK+TTFH PKTL LSRAPKYPRRS+P QPRLDA Sbjct: 25 TLRGVNSHKVTKVRKSTTFHQPKTLTLSRAPKYPRRSIPRQPRLDA 70 >ref|XP_007675420.1| hypothetical protein BAUCODRAFT_68260, partial [Baudoinia panamericana UAMH 10762] gi|449300951|gb|EMC96962.1| hypothetical protein BAUCODRAFT_68260, partial [Baudoinia panamericana UAMH 10762] Length = 145 Score = 83.6 bits (205), Expect = 5e-14 Identities = 38/46 (82%), Positives = 41/46 (89%) Frame = -1 Query: 140 TLRGVNSHKTHKVRKNTTFHLPKTLQLSRAPKYPRRSVPHQPRLDA 3 TLRGVNSHK KVR NT+FH PKTL LSRAPKYPR+SVPH+PRLDA Sbjct: 16 TLRGVNSHKVRKVRTNTSFHRPKTLTLSRAPKYPRKSVPHEPRLDA 61 >ref|XP_007927050.1| hypothetical protein MYCFIDRAFT_52665 [Pseudocercospora fijiensis CIRAD86] gi|452982570|gb|EME82329.1| hypothetical protein MYCFIDRAFT_52665 [Pseudocercospora fijiensis CIRAD86] Length = 159 Score = 82.0 bits (201), Expect = 2e-13 Identities = 37/46 (80%), Positives = 42/46 (91%) Frame = -1 Query: 140 TLRGVNSHKTHKVRKNTTFHLPKTLQLSRAPKYPRRSVPHQPRLDA 3 TLRGVNSHK KVRK+T+FHLPKTL +SRAPKYPR+S+P QPRLDA Sbjct: 30 TLRGVNSHKVTKVRKSTSFHLPKTLTISRAPKYPRKSIPSQPRLDA 75 >ref|XP_008084021.1| Ribosomal proteins S24e, L23 and L15e [Glarea lozoyensis ATCC 20868] gi|512201080|gb|EPE29912.1| Ribosomal proteins S24e, L23 and L15e [Glarea lozoyensis ATCC 20868] Length = 156 Score = 81.3 bits (199), Expect = 3e-13 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = -1 Query: 137 LRGVNSHKTHKVRKNTTFHLPKTLQLSRAPKYPRRSVPHQPRLD 6 L+GV+SHK KVRK+TTFH PKTLQLSR+PKYPR+SVPHQPRLD Sbjct: 28 LKGVHSHKVRKVRKSTTFHRPKTLQLSRSPKYPRKSVPHQPRLD 71 >ref|XP_001273898.1| 60S ribosomal protein L25 [Aspergillus clavatus NRRL 1] gi|119402051|gb|EAW12472.1| 60S ribosomal protein L23 [Aspergillus clavatus NRRL 1] Length = 154 Score = 79.0 bits (193), Expect = 1e-12 Identities = 32/45 (71%), Positives = 41/45 (91%) Frame = -1 Query: 137 LRGVNSHKTHKVRKNTTFHLPKTLQLSRAPKYPRRSVPHQPRLDA 3 L+G +HK+HK+R +TTFH PKTLQLSR+PKYPR+S+PH+PRLDA Sbjct: 26 LKGAGAHKSHKIRTSTTFHRPKTLQLSRSPKYPRKSIPHEPRLDA 70 >ref|XP_008717630.1| hypothetical protein HMPREF1541_05067 [Cyphellophora europaea CBS 101466] gi|568118171|gb|ETN40787.1| hypothetical protein HMPREF1541_05067 [Cyphellophora europaea CBS 101466] Length = 155 Score = 78.6 bits (192), Expect = 2e-12 Identities = 34/45 (75%), Positives = 41/45 (91%) Frame = -1 Query: 140 TLRGVNSHKTHKVRKNTTFHLPKTLQLSRAPKYPRRSVPHQPRLD 6 TLRGVN++K K+R +TTFH PKTLQLSR+PKYPR+SVPH+PRLD Sbjct: 26 TLRGVNANKARKIRTSTTFHRPKTLQLSRSPKYPRKSVPHEPRLD 70 >ref|XP_007294929.1| 60S ribosomal protein L25 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406861776|gb|EKD14829.1| 60S ribosomal protein L25 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 168 Score = 78.6 bits (192), Expect = 2e-12 Identities = 35/44 (79%), Positives = 40/44 (90%) Frame = -1 Query: 137 LRGVNSHKTHKVRKNTTFHLPKTLQLSRAPKYPRRSVPHQPRLD 6 L+GV+SHK KVR +TTFH PKTLQLSRAPKYPR+SVPH+PRLD Sbjct: 40 LKGVHSHKVRKVRLSTTFHRPKTLQLSRAPKYPRKSVPHEPRLD 83 >ref|XP_963077.1| 60S ribosomal protein L25 [Neurospora crassa OR74A] gi|698987498|ref|XP_009850730.1| 60S ribosomal protein L25 [Neurospora tetrasperma FGSC 2508] gi|28924728|gb|EAA33841.1| 60S ribosomal protein L25 [Neurospora crassa OR74A] gi|336469469|gb|EGO57631.1| 60S ribosomal protein L25 [Neurospora tetrasperma FGSC 2508] gi|350290887|gb|EGZ72101.1| 60S ribosomal protein L25 [Neurospora tetrasperma FGSC 2509] gi|725984072|gb|KHE87059.1| 60S ribosomal protein L25 [Neurospora crassa] Length = 156 Score = 77.0 bits (188), Expect = 5e-12 Identities = 34/44 (77%), Positives = 40/44 (90%) Frame = -1 Query: 137 LRGVNSHKTHKVRKNTTFHLPKTLQLSRAPKYPRRSVPHQPRLD 6 L+GV+SHK KVR +TTFH PKTLQLSRAPKYPR+S+PH+PRLD Sbjct: 28 LKGVHSHKKTKVRYSTTFHRPKTLQLSRAPKYPRKSIPHEPRLD 71 >ref|XP_006692828.1| 60S ribosomal protein L25-like protein [Chaetomium thermophilum var. thermophilum DSM 1495] gi|340959351|gb|EGS20532.1| 60S ribosomal protein L25-like protein [Chaetomium thermophilum var. thermophilum DSM 1495] Length = 156 Score = 77.0 bits (188), Expect = 5e-12 Identities = 34/44 (77%), Positives = 40/44 (90%) Frame = -1 Query: 137 LRGVNSHKTHKVRKNTTFHLPKTLQLSRAPKYPRRSVPHQPRLD 6 L+GV+SHK KVRK+TTFH PKTL LSRAPKYPR+S+PH+PRLD Sbjct: 28 LKGVHSHKKTKVRKSTTFHRPKTLVLSRAPKYPRKSIPHEPRLD 71 >ref|XP_003345807.1| 60S ribosomal protein L25 [Sordaria macrospora k-hell] gi|380088581|emb|CCC13467.1| unnamed protein product [Sordaria macrospora k-hell] Length = 185 Score = 76.6 bits (187), Expect = 7e-12 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = -1 Query: 137 LRGVNSHKTHKVRKNTTFHLPKTLQLSRAPKYPRRSVPHQPRLD 6 L+GV+SHK KVR +TTFH PKTLQLSRAPKYPR+S+PH PRLD Sbjct: 57 LKGVHSHKATKVRHSTTFHQPKTLQLSRAPKYPRKSIPHAPRLD 100 >ref|XP_007912405.1| putative 60s ribosomal protein l25 protein [Togninia minima UCRPA7] gi|500260146|gb|EOO02849.1| putative 60s ribosomal protein l25 protein [Phaeoacremonium minimum UCRPA7] Length = 156 Score = 76.6 bits (187), Expect = 7e-12 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = -1 Query: 137 LRGVNSHKTHKVRKNTTFHLPKTLQLSRAPKYPRRSVPHQPRLD 6 L+GV+SHK KVR T+FH PKTLQLSRAPKYPR+SVPH+PRLD Sbjct: 28 LKGVHSHKARKVRLTTSFHRPKTLQLSRAPKYPRKSVPHEPRLD 71 >dbj|GAQ09041.1| 60S ribosomal protein L25 [Aspergillus lentulus] Length = 154 Score = 75.9 bits (185), Expect = 1e-11 Identities = 31/45 (68%), Positives = 40/45 (88%) Frame = -1 Query: 137 LRGVNSHKTHKVRKNTTFHLPKTLQLSRAPKYPRRSVPHQPRLDA 3 L+G +HK+ K+R +TTFH PKTLQLSR+PKYPR+S+PH+PRLDA Sbjct: 26 LKGAGAHKSRKIRTSTTFHRPKTLQLSRSPKYPRKSIPHEPRLDA 70 >dbj|GAO82200.1| 60S ribosomal protein L25 [Neosartorya udagawae] Length = 154 Score = 75.9 bits (185), Expect = 1e-11 Identities = 31/45 (68%), Positives = 40/45 (88%) Frame = -1 Query: 137 LRGVNSHKTHKVRKNTTFHLPKTLQLSRAPKYPRRSVPHQPRLDA 3 L+G +HK+ K+R +TTFH PKTLQLSR+PKYPR+S+PH+PRLDA Sbjct: 26 LKGAGAHKSRKIRTSTTFHRPKTLQLSRSPKYPRKSIPHEPRLDA 70 >gb|KMK59218.1| 60S ribosomal protein L23 [Aspergillus fumigatus Z5] Length = 154 Score = 75.9 bits (185), Expect = 1e-11 Identities = 31/45 (68%), Positives = 40/45 (88%) Frame = -1 Query: 137 LRGVNSHKTHKVRKNTTFHLPKTLQLSRAPKYPRRSVPHQPRLDA 3 L+G +HK+ K+R +TTFH PKTLQLSR+PKYPR+S+PH+PRLDA Sbjct: 26 LKGTGAHKSRKIRTSTTFHRPKTLQLSRSPKYPRKSIPHEPRLDA 70 >gb|KKK26734.1| 60S ribosomal protein [Aspergillus rambellii] Length = 152 Score = 75.9 bits (185), Expect = 1e-11 Identities = 32/45 (71%), Positives = 39/45 (86%) Frame = -1 Query: 137 LRGVNSHKTHKVRKNTTFHLPKTLQLSRAPKYPRRSVPHQPRLDA 3 L+G +HKT K+R +TTFH PKTLQLSR+PKYPR+S+PH PRLDA Sbjct: 24 LKGAGAHKTRKIRTSTTFHRPKTLQLSRSPKYPRKSIPHVPRLDA 68 >gb|KKK15310.1| 60S ribosomal protein, partial [Aspergillus ochraceoroseus] Length = 142 Score = 75.9 bits (185), Expect = 1e-11 Identities = 32/45 (71%), Positives = 39/45 (86%) Frame = -1 Query: 137 LRGVNSHKTHKVRKNTTFHLPKTLQLSRAPKYPRRSVPHQPRLDA 3 L+G +HKT K+R +TTFH PKTLQLSR+PKYPR+S+PH PRLDA Sbjct: 14 LKGAGAHKTRKIRTSTTFHRPKTLQLSRSPKYPRKSIPHVPRLDA 58