BLASTX nr result
ID: Cinnamomum24_contig00036204
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00036204 (313 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME42741.1| hypothetical protein DOTSEDRAFT_73516 [Dothistrom... 60 6e-07 >gb|EME42741.1| hypothetical protein DOTSEDRAFT_73516 [Dothistroma septosporum NZE10] Length = 250 Score = 60.1 bits (144), Expect = 6e-07 Identities = 33/68 (48%), Positives = 40/68 (58%), Gaps = 1/68 (1%) Frame = -2 Query: 309 GAIGGFGNYINSYGNGIKDSMAASGG-GNVEKKTAVKPTTAVSKAVSQPKKPMPVTTSTS 133 GAIGG G YIN+YG I D+ A SGG G+ EKKTAVKP+TA A ++ S Sbjct: 53 GAIGGVGGYINNYGQSIIDATAPSGGSGSAEKKTAVKPSTASKPASKPAVSAQKSASAVS 112 Query: 132 KPATSNAS 109 KP A+ Sbjct: 113 KPKAVTAT 120