BLASTX nr result
ID: Cinnamomum24_contig00036184
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00036184 (294 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERN11393.1| hypothetical protein AMTR_s00176p00065670 [Ambore... 67 5e-09 >gb|ERN11393.1| hypothetical protein AMTR_s00176p00065670 [Amborella trichopoda] Length = 259 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/53 (60%), Positives = 37/53 (69%) Frame = -1 Query: 165 DFTRKKQILARGTELPTCITNGKTQLKTVYVFAKQSLVILRVRTKHLGGAFTT 7 D T Q LA G +LPTC NGKT+LK VY++ KQS V LR+R KH GG FTT Sbjct: 135 DLTLNCQALAMGRDLPTCTENGKTKLKRVYIYMKQSHVFLRLRNKHWGGIFTT 187