BLASTX nr result
ID: Cinnamomum24_contig00036119
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00036119 (315 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CRK25497.1| hypothetical protein BN1723_013583 [Verticillium... 113 6e-23 emb|CCT65955.1| probable RPL39-60S large subunit ribosomal prote... 113 6e-23 emb|CEF83650.1| unnamed protein product [Fusarium graminearum] 110 3e-22 gb|KFY76831.1| hypothetical protein V499_03609 [Pseudogymnoascus... 110 5e-22 ref|XP_002544670.1| predicted protein [Uncinocarpus reesii 1704]... 109 9e-22 gb|EME43136.1| hypothetical protein DOTSEDRAFT_173805 [Dothistro... 108 1e-21 gb|EHL00026.1| putative 60S ribosomal protein L39 [Glarea lozoye... 108 1e-21 ref|XP_003003166.1| 60S ribosomal protein L39 [Verticillium alfa... 107 3e-21 ref|XP_003850033.1| 60S ribosomal protein L39 [Zymoseptoria trit... 107 3e-21 ref|XP_002848813.1| hypothetical protein MCYG_01747 [Arthroderma... 107 3e-21 ref|XP_003051759.1| 60S ribosomal protein L39 [Nectria haematoco... 107 3e-21 gb|KFY64732.1| hypothetical protein V496_03067 [Pseudogymnoascus... 107 5e-21 ref|XP_002482271.1| ribosomal protein L39e, putative [Talaromyce... 107 5e-21 ref|XP_007675548.1| hypothetical protein BAUCODRAFT_147112 [Baud... 107 5e-21 ref|XP_001542836.1| 60S ribosomal protein L39 [Histoplasma capsu... 107 5e-21 gb|KEY67153.1| hypothetical protein S7711_03013 [Stachybotrys ch... 106 6e-21 gb|EMF12058.1| ribosomal protein L39e [Sphaerulina musiva SO2202] 106 6e-21 emb|CCX04754.1| Protein of unknown function [Pyronema omphalodes... 106 8e-21 gb|EPS27305.1| hypothetical protein PDE_02248 [Penicillium oxali... 105 1e-20 ref|XP_003189071.1| 60S ribosomal protein L39 [Aspergillus oryza... 105 1e-20 >emb|CRK25497.1| hypothetical protein BN1723_013583 [Verticillium longisporum] Length = 151 Score = 113 bits (282), Expect = 6e-23 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = -1 Query: 282 NTVKMPSHKSFRTKVKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 118 NTV MPSHKSFRTKVKLAKAQKQNRPIPQW+RLRTGNTIRYNAKRRHWRKT++GI Sbjct: 97 NTVTMPSHKSFRTKVKLAKAQKQNRPIPQWVRLRTGNTIRYNAKRRHWRKTKLGI 151 >emb|CCT65955.1| probable RPL39-60S large subunit ribosomal protein L39.e [Fusarium fujikuroi IMI 58289] Length = 93 Score = 113 bits (282), Expect = 6e-23 Identities = 52/55 (94%), Positives = 53/55 (96%) Frame = -1 Query: 282 NTVKMPSHKSFRTKVKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 118 N VKMPSHKSFRTK KLAKAQKQNRP+PQWIRLRTGNTIRYNAKRRHWRKTRIGI Sbjct: 39 NAVKMPSHKSFRTKQKLAKAQKQNRPVPQWIRLRTGNTIRYNAKRRHWRKTRIGI 93 >emb|CEF83650.1| unnamed protein product [Fusarium graminearum] Length = 68 Score = 110 bits (276), Expect = 3e-22 Identities = 51/55 (92%), Positives = 52/55 (94%) Frame = -1 Query: 282 NTVKMPSHKSFRTKVKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 118 N V MPSHKSFRTK KLAKAQKQNRP+PQWIRLRTGNTIRYNAKRRHWRKTRIGI Sbjct: 14 NAVTMPSHKSFRTKQKLAKAQKQNRPVPQWIRLRTGNTIRYNAKRRHWRKTRIGI 68 >gb|KFY76831.1| hypothetical protein V499_03609 [Pseudogymnoascus pannorum VKM F-103] Length = 89 Score = 110 bits (274), Expect = 5e-22 Identities = 51/52 (98%), Positives = 51/52 (98%) Frame = -1 Query: 273 KMPSHKSFRTKVKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 118 KMPSHKSFRTKVKLAKAQK NRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI Sbjct: 38 KMPSHKSFRTKVKLAKAQKSNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 89 >ref|XP_002544670.1| predicted protein [Uncinocarpus reesii 1704] gi|237904940|gb|EEP79341.1| predicted protein [Uncinocarpus reesii 1704] Length = 183 Score = 109 bits (272), Expect = 9e-22 Identities = 51/55 (92%), Positives = 52/55 (94%) Frame = -1 Query: 282 NTVKMPSHKSFRTKVKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 118 N VKMPS KSFRTK KLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTR+GI Sbjct: 129 NPVKMPSQKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 183 >gb|EME43136.1| hypothetical protein DOTSEDRAFT_173805 [Dothistroma septosporum NZE10] Length = 51 Score = 108 bits (271), Expect = 1e-21 Identities = 50/51 (98%), Positives = 51/51 (100%) Frame = -1 Query: 270 MPSHKSFRTKVKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 118 MPSHK+FRTKVKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI Sbjct: 1 MPSHKTFRTKVKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 51 >gb|EHL00026.1| putative 60S ribosomal protein L39 [Glarea lozoyensis 74030] Length = 51 Score = 108 bits (271), Expect = 1e-21 Identities = 50/51 (98%), Positives = 51/51 (100%) Frame = -1 Query: 270 MPSHKSFRTKVKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 118 MPSHKSFRTKVKLA+AQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI Sbjct: 1 MPSHKSFRTKVKLARAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 51 >ref|XP_003003166.1| 60S ribosomal protein L39 [Verticillium alfalfae VaMs.102] gi|697079459|ref|XP_009653481.1| 60S ribosomal protein L39 [Verticillium dahliae VdLs.17] gi|261358190|gb|EEY20618.1| 60S ribosomal protein L39 [Verticillium alfalfae VaMs.102] gi|346971173|gb|EGY14625.1| 60S ribosomal protein L39 [Verticillium dahliae VdLs.17] gi|913772584|emb|CRK30714.1| hypothetical protein BN1708_015843 [Verticillium longisporum] Length = 51 Score = 107 bits (268), Expect = 3e-21 Identities = 48/51 (94%), Positives = 51/51 (100%) Frame = -1 Query: 270 MPSHKSFRTKVKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 118 MPSHKSFRTKVKLAKAQKQNRPIPQW+RLRTGNTIRYNAKRRHWRKT++GI Sbjct: 1 MPSHKSFRTKVKLAKAQKQNRPIPQWVRLRTGNTIRYNAKRRHWRKTKLGI 51 >ref|XP_003850033.1| 60S ribosomal protein L39 [Zymoseptoria tritici IPO323] gi|667834302|ref|XP_007781320.1| 60S ribosomal protein L39 [Coniosporium apollinis CBS 100218] gi|339469911|gb|EGP85009.1| hypothetical protein MYCGRDRAFT_105463 [Zymoseptoria tritici IPO323] gi|494829312|gb|EON66003.1| 60S ribosomal protein L39 [Coniosporium apollinis CBS 100218] gi|751758072|gb|KIN06246.1| hypothetical protein OIDMADRAFT_38580 [Oidiodendron maius Zn] gi|752278391|dbj|GAM86723.1| hypothetical protein ANO11243_047420 [fungal sp. No.11243] gi|796708356|gb|KJX99510.1| 60S ribosomal protein L39 [Zymoseptoria brevis] Length = 51 Score = 107 bits (268), Expect = 3e-21 Identities = 50/51 (98%), Positives = 50/51 (98%) Frame = -1 Query: 270 MPSHKSFRTKVKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 118 MPSHKSFRTK KLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI Sbjct: 1 MPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 51 >ref|XP_002848813.1| hypothetical protein MCYG_01747 [Arthroderma otae CBS 113480] gi|238839266|gb|EEQ28928.1| hypothetical protein MCYG_01747 [Arthroderma otae CBS 113480] Length = 94 Score = 107 bits (268), Expect = 3e-21 Identities = 50/54 (92%), Positives = 52/54 (96%) Frame = -1 Query: 279 TVKMPSHKSFRTKVKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 118 +VKMPS KSFRTK KLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTR+GI Sbjct: 41 SVKMPSQKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 94 >ref|XP_003051759.1| 60S ribosomal protein L39 [Nectria haematococca mpVI 77-13-4] gi|685872197|ref|XP_009263131.1| hypothetical protein FPSE_11739 [Fusarium pseudograminearum CS3096] gi|758208834|ref|XP_011326588.1| hypothetical protein FGSG_06921 [Fusarium graminearum PH-1] gi|256732698|gb|EEU46046.1| predicted protein [Nectria haematococca mpVI 77-13-4] gi|342865967|gb|EGU71968.1| hypothetical protein FOXB_17529 [Fusarium oxysporum Fo5176] gi|408388242|gb|EKJ67928.1| hypothetical protein FPSE_11739 [Fusarium pseudograminearum CS3096] gi|558862998|gb|ESU13081.1| hypothetical protein FGSG_06921 [Fusarium graminearum PH-1] gi|584139211|gb|EWG48551.1| 60S ribosomal protein L39 [Fusarium verticillioides 7600] gi|587676271|gb|EWY98599.1| 60S ribosomal protein L39 [Fusarium oxysporum FOSC 3-a] gi|587698070|gb|EWZ44675.1| 60S ribosomal protein L39 [Fusarium oxysporum Fo47] gi|587727111|gb|EWZ98448.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. lycopersici MN25] gi|587752242|gb|EXA49958.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. pisi HDV247] gi|590040183|gb|EXK42041.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. melonis 26406] gi|590073088|gb|EXL00613.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. raphani 54005] gi|591426865|gb|EXL62002.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591453858|gb|EXL86129.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591463667|gb|EXL95148.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591507348|gb|EXM36611.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. vasinfectum 25433] gi|596543402|gb|EYB23707.1| hypothetical protein FG05_06921 [Fusarium graminearum] gi|829113621|gb|KLO90055.1| putative RPL39-60S large subunit ribosomal protein L39.e [Fusarium fujikuroi] gi|829136452|gb|KLP09859.1| putative RPL39-60S large subunit ribosomal protein L39.e [Fusarium fujikuroi] gi|829151008|gb|KLP19369.1| putative RPL39-60S large subunit ribosomal protein L39.e [Fusarium fujikuroi] Length = 51 Score = 107 bits (267), Expect = 3e-21 Identities = 49/51 (96%), Positives = 50/51 (98%) Frame = -1 Query: 270 MPSHKSFRTKVKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 118 MPSHKSFRTK KLAKAQKQNRP+PQWIRLRTGNTIRYNAKRRHWRKTRIGI Sbjct: 1 MPSHKSFRTKQKLAKAQKQNRPVPQWIRLRTGNTIRYNAKRRHWRKTRIGI 51 >gb|KFY64732.1| hypothetical protein V496_03067 [Pseudogymnoascus pannorum VKM F-4515 (FW-2607)] Length = 126 Score = 107 bits (266), Expect = 5e-21 Identities = 53/63 (84%), Positives = 54/63 (85%), Gaps = 2/63 (3%) Frame = -1 Query: 300 TEDIGDNTVKMP--SHKSFRTKVKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTR 127 TE NT +P SHKSFRTKVKLAKAQK NRPIPQWIRLRTGNTIRYNAKRRHWRKTR Sbjct: 64 TEQRTKNTADIPPQSHKSFRTKVKLAKAQKSNRPIPQWIRLRTGNTIRYNAKRRHWRKTR 123 Query: 126 IGI 118 IGI Sbjct: 124 IGI 126 >ref|XP_002482271.1| ribosomal protein L39e, putative [Talaromyces stipitatus ATCC 10500] gi|218718859|gb|EED18279.1| ribosomal protein L39e, putative [Talaromyces stipitatus ATCC 10500] Length = 109 Score = 107 bits (266), Expect = 5e-21 Identities = 49/53 (92%), Positives = 51/53 (96%) Frame = -1 Query: 276 VKMPSHKSFRTKVKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 118 +KMPS KSFRTK KLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTR+GI Sbjct: 57 IKMPSQKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 109 >ref|XP_007675548.1| hypothetical protein BAUCODRAFT_147112 [Baudoinia panamericana UAMH 10762] gi|449300902|gb|EMC96913.1| hypothetical protein BAUCODRAFT_147112 [Baudoinia panamericana UAMH 10762] Length = 51 Score = 107 bits (266), Expect = 5e-21 Identities = 49/51 (96%), Positives = 50/51 (98%) Frame = -1 Query: 270 MPSHKSFRTKVKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 118 MPSHKSFRTK KLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIG+ Sbjct: 1 MPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGL 51 >ref|XP_001542836.1| 60S ribosomal protein L39 [Histoplasma capsulatum NAm1] gi|327292414|ref|XP_003230906.1| 60S ribosomal protein L39 [Trichophyton rubrum CBS 118892] gi|389629646|ref|XP_003712476.1| 60S ribosomal protein L39 [Magnaporthe oryzae 70-15] gi|615467304|ref|XP_007599880.1| hypothetical protein CFIO01_13564 [Colletotrichum fioriniae PJ7] gi|636583219|ref|XP_008022948.1| hypothetical protein SETTUDRAFT_46231 [Setosphaeria turcica Et28A] gi|685402138|ref|XP_009219929.1| 60S ribosomal protein L39 [Gaeumannomyces graminis var. tritici R3-111a-1] gi|150411016|gb|EDN06404.1| ribosomal protein L39 [Histoplasma capsulatum NAm1] gi|259487695|tpe|CBF86564.1| TPA: conserved hypothetical protein [Aspergillus nidulans FGSC A4] gi|351644808|gb|EHA52669.1| 60S ribosomal protein L39 [Magnaporthe oryzae 70-15] gi|402083766|gb|EJT78784.1| 60S ribosomal protein L39 [Gaeumannomyces graminis var. tritici R3-111a-1] gi|440475962|gb|ELQ44608.1| hypothetical protein OOU_Y34scaffold00071g24 [Magnaporthe oryzae Y34] gi|440487781|gb|ELQ67556.1| hypothetical protein OOW_P131scaffold00314g129 [Magnaporthe oryzae P131] gi|482812667|gb|EOA89386.1| hypothetical protein SETTUDRAFT_46231 [Setosphaeria turcica Et28A] gi|550808028|gb|ERS99941.1| 60S ribosomal protein L39 [Sporothrix schenckii ATCC 58251] gi|588894534|gb|EXF76478.1| hypothetical protein CFIO01_13564 [Colletotrichum fioriniae PJ7] gi|607883430|gb|EZF28033.1| 60S ribosomal protein L39 [Trichophyton rubrum MR850] gi|607910227|gb|EZF47097.1| 60S ribosomal protein L39 [Trichophyton rubrum CBS 100081] gi|607922284|gb|EZF57748.1| 60S ribosomal protein L39 [Trichophyton rubrum CBS 288.86] gi|607934286|gb|EZF68319.1| 60S ribosomal protein L39 [Trichophyton rubrum CBS 289.86] gi|607946260|gb|EZF79023.1| 60S ribosomal protein L39 [Trichophyton soudanense CBS 452.61] gi|607958340|gb|EZF89637.1| 60S ribosomal protein L39 [Trichophyton rubrum MR1448] gi|607970581|gb|EZG00476.1| 60S ribosomal protein L39 [Trichophyton rubrum MR1459] gi|607976489|gb|EZG05683.1| 60S ribosomal protein L39 [Trichophyton rubrum CBS 735.88] gi|607994655|gb|EZG22078.1| 60S ribosomal protein L39 [Trichophyton rubrum CBS 202.88] gi|633064723|gb|KDB38828.1| 60S ribosomal protein L39 [Trichophyton rubrum D6] gi|835888956|gb|KLU81216.1| 60S ribosomal protein L39 [Magnaporthiopsis poae ATCC 64411] Length = 51 Score = 107 bits (266), Expect = 5e-21 Identities = 49/51 (96%), Positives = 50/51 (98%) Frame = -1 Query: 270 MPSHKSFRTKVKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 118 MPSHKSFRTK KLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTR+GI Sbjct: 1 MPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51 >gb|KEY67153.1| hypothetical protein S7711_03013 [Stachybotrys chartarum IBT 7711] gi|667517347|gb|KFA46797.1| hypothetical protein S40293_06785 [Stachybotrys chartarum IBT 40293] gi|667735668|gb|KFA75011.1| hypothetical protein S40288_02227 [Stachybotrys chartarum IBT 40288] Length = 51 Score = 106 bits (265), Expect = 6e-21 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = -1 Query: 270 MPSHKSFRTKVKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 118 MPSHKSFRTK KLAKAQKQNRP+PQWIRLRTGNTIRYNAKRRHWRKTR+GI Sbjct: 1 MPSHKSFRTKQKLAKAQKQNRPVPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51 >gb|EMF12058.1| ribosomal protein L39e [Sphaerulina musiva SO2202] Length = 51 Score = 106 bits (265), Expect = 6e-21 Identities = 49/51 (96%), Positives = 50/51 (98%) Frame = -1 Query: 270 MPSHKSFRTKVKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 118 MPSHK+FRTK KLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI Sbjct: 1 MPSHKTFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 51 >emb|CCX04754.1| Protein of unknown function [Pyronema omphalodes CBS 100304] Length = 51 Score = 106 bits (264), Expect = 8e-21 Identities = 49/51 (96%), Positives = 50/51 (98%) Frame = -1 Query: 270 MPSHKSFRTKVKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 118 MPS KSFRTKVKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTR+GI Sbjct: 1 MPSQKSFRTKVKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51 >gb|EPS27305.1| hypothetical protein PDE_02248 [Penicillium oxalicum 114-2] Length = 51 Score = 105 bits (263), Expect = 1e-20 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = -1 Query: 270 MPSHKSFRTKVKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 118 MPSHK+FRTK KLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTR+GI Sbjct: 1 MPSHKTFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51 >ref|XP_003189071.1| 60S ribosomal protein L39 [Aspergillus oryzae RIB40] gi|914753498|gb|KOC07663.1| 60S ribosomal protein [Aspergillus flavus AF70] Length = 51 Score = 105 bits (263), Expect = 1e-20 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = -1 Query: 270 MPSHKSFRTKVKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 118 MPSHKSFRTK KLAKAQ+QNRPIPQWIRLRTGNTIRYNAKRRHWRKTR+GI Sbjct: 1 MPSHKSFRTKQKLAKAQRQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51