BLASTX nr result
ID: Cinnamomum24_contig00035948
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00035948 (216 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007920842.1| hypothetical protein MYCFIDRAFT_169220 [Pseu... 59 1e-06 gb|EME49513.1| hypothetical protein DOTSEDRAFT_68323 [Dothistrom... 56 9e-06 >ref|XP_007920842.1| hypothetical protein MYCFIDRAFT_169220 [Pseudocercospora fijiensis CIRAD86] gi|452987626|gb|EME87381.1| hypothetical protein MYCFIDRAFT_169220 [Pseudocercospora fijiensis CIRAD86] Length = 531 Score = 59.3 bits (142), Expect = 1e-06 Identities = 35/73 (47%), Positives = 45/73 (61%), Gaps = 5/73 (6%) Frame = -1 Query: 216 PHTSHKNDPMKPYI---STQRGEMPTGYVPFANIYGGDPCA--PPHFVQPPLSEHGSVQP 52 P S+ + P++ ST RG M TGYVP+A+IYGG A P+F PP S+ SVQP Sbjct: 198 PSLSNHSGGTNPFVRSTSTLRGGMATGYVPYAHIYGGPKQANDSPNFAPPP-SDTASVQP 256 Query: 51 TLMNQVSPPVAGQ 13 +NQV+ PVA Q Sbjct: 257 NSLNQVAAPVAQQ 269 >gb|EME49513.1| hypothetical protein DOTSEDRAFT_68323 [Dothistroma septosporum NZE10] Length = 349 Score = 56.2 bits (134), Expect = 9e-06 Identities = 31/54 (57%), Positives = 34/54 (62%) Frame = -1 Query: 174 STQRGEMPTGYVPFANIYGGDPCAPPHFVQPPLSEHGSVQPTLMNQVSPPVAGQ 13 ST RG M TGYVP+ANIYG +P Q P S+ GSVQP NQV PPV Q Sbjct: 194 STLRGGMATGYVPYANIYG----SPTQAQQYPPSDTGSVQPNHTNQVGPPVQPQ 243