BLASTX nr result
ID: Cinnamomum24_contig00035880
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00035880 (252 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMF13956.1| hypothetical protein SEPMUDRAFT_40409 [Sphaerulin... 81 3e-13 gb|KJX94624.1| hypothetical protein TI39_contig4173g00025 [Zymos... 80 8e-13 gb|EME46514.1| hypothetical protein DOTSEDRAFT_61143 [Dothistrom... 77 4e-12 ref|XP_007674016.1| hypothetical protein BAUCODRAFT_385071 [Baud... 75 2e-11 ref|XP_007926760.1| hypothetical protein MYCFIDRAFT_211371 [Pseu... 74 6e-11 gb|KEQ81513.1| hypothetical protein M438DRAFT_348010 [Aureobasid... 71 3e-10 ref|XP_003853506.1| hypothetical protein MYCGRDRAFT_39970, parti... 69 1e-09 ref|XP_013432373.1| hypothetical protein M436DRAFT_77521 [Aureob... 68 3e-09 gb|KEQ67236.1| hypothetical protein M437DRAFT_79890 [Aureobasidi... 68 3e-09 gb|KIW08815.1| hypothetical protein, variant [Verruconis gallopava] 66 9e-09 gb|KIW08814.1| hypothetical protein PV09_00746 [Verruconis gallo... 66 9e-09 ref|XP_001935049.1| conserved hypothetical protein [Pyrenophora ... 64 3e-08 ref|XP_008020428.1| hypothetical protein SETTUDRAFT_85840 [Setos... 64 6e-08 dbj|GAM90763.1| hypothetical protein ANO11243_088080 [fungal sp.... 63 7e-08 ref|XP_001804409.1| hypothetical protein SNOG_14212 [Parastagono... 63 7e-08 ref|XP_007692363.1| hypothetical protein COCMIDRAFT_40656 [Bipol... 63 1e-07 ref|XP_003299248.1| hypothetical protein PTT_10198 [Pyrenophora ... 63 1e-07 ref|XP_007712198.1| hypothetical protein COCCADRAFT_95942 [Bipol... 62 1e-07 ref|XP_007782430.1| hypothetical protein W97_06366 [Coniosporium... 62 1e-07 ref|XP_014077955.1| hypothetical protein COCC4DRAFT_171808 [Bipo... 62 1e-07 >gb|EMF13956.1| hypothetical protein SEPMUDRAFT_40409 [Sphaerulina musiva SO2202] Length = 125 Score = 81.3 bits (199), Expect = 3e-13 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -2 Query: 116 MSKSLNVFKQPLSLHSTSPMTGFLRNGYCEVPGSDYGN 3 MSKSLNVFKQPL+LHSTSPMTG+LRNGYCEVPGSDYGN Sbjct: 1 MSKSLNVFKQPLTLHSTSPMTGYLRNGYCEVPGSDYGN 38 >gb|KJX94624.1| hypothetical protein TI39_contig4173g00025 [Zymoseptoria brevis] Length = 162 Score = 79.7 bits (195), Expect = 8e-13 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -2 Query: 116 MSKSLNVFKQPLSLHSTSPMTGFLRNGYCEVPGSDYGN 3 MSKSLNVFKQPLSLHSTSPMTGFLRNGYCEVP SD+GN Sbjct: 38 MSKSLNVFKQPLSLHSTSPMTGFLRNGYCEVPSSDFGN 75 >gb|EME46514.1| hypothetical protein DOTSEDRAFT_61143 [Dothistroma septosporum NZE10] Length = 124 Score = 77.4 bits (189), Expect = 4e-12 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -2 Query: 116 MSKSLNVFKQPLSLHSTSPMTGFLRNGYCEVPGSDYGN 3 MSKSLNVFKQPL+LHSTSPMTG+LRNGYCEVP SD+GN Sbjct: 1 MSKSLNVFKQPLALHSTSPMTGYLRNGYCEVPASDFGN 38 >ref|XP_007674016.1| hypothetical protein BAUCODRAFT_385071 [Baudoinia panamericana UAMH 10762] gi|449302914|gb|EMC98922.1| hypothetical protein BAUCODRAFT_385071 [Baudoinia panamericana UAMH 10762] Length = 125 Score = 74.7 bits (182), Expect = 2e-11 Identities = 32/38 (84%), Positives = 37/38 (97%) Frame = -2 Query: 116 MSKSLNVFKQPLSLHSTSPMTGFLRNGYCEVPGSDYGN 3 MSKSLNVFK+PL+LHST+PMTG+LRNGYCEVP SD+GN Sbjct: 1 MSKSLNVFKKPLALHSTNPMTGYLRNGYCEVPASDFGN 38 >ref|XP_007926760.1| hypothetical protein MYCFIDRAFT_211371 [Pseudocercospora fijiensis CIRAD86] gi|452983818|gb|EME83576.1| hypothetical protein MYCFIDRAFT_211371 [Pseudocercospora fijiensis CIRAD86] Length = 166 Score = 73.6 bits (179), Expect = 6e-11 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = -2 Query: 116 MSKSLNVFKQPLSLHSTSPMTGFLRNGYCEVPGSDYGN 3 MSKSLNVFKQPL+LHSTSP+TG+LR GYCEVP SD+GN Sbjct: 1 MSKSLNVFKQPLTLHSTSPITGYLRTGYCEVPASDFGN 38 >gb|KEQ81513.1| hypothetical protein M438DRAFT_348010 [Aureobasidium pullulans EXF-150] Length = 157 Score = 71.2 bits (173), Expect = 3e-10 Identities = 35/73 (47%), Positives = 46/73 (63%) Frame = -2 Query: 221 MYVSTLVVLSTTLIPLSIXXXXXXXXXXXXXXHPKMSKSLNVFKQPLSLHSTSPMTGFLR 42 M+ ++L++ L +SI KMS+SLNV +PL++HSTSPMTG+LR Sbjct: 1 MHSTSLLITLLCLAAISITASASAHNQLHQQHQLKMSRSLNVLSKPLAIHSTSPMTGYLR 60 Query: 41 NGYCEVPGSDYGN 3 NGYCEVP SD GN Sbjct: 61 NGYCEVPASDAGN 73 >ref|XP_003853506.1| hypothetical protein MYCGRDRAFT_39970, partial [Zymoseptoria tritici IPO323] gi|339473388|gb|EGP88482.1| hypothetical protein MYCGRDRAFT_39970, partial [Zymoseptoria tritici IPO323] Length = 119 Score = 68.9 bits (167), Expect = 1e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -2 Query: 98 VFKQPLSLHSTSPMTGFLRNGYCEVPGSDYGN 3 VFKQPLSLHSTSPMTGFLRNGYCEVP SD+GN Sbjct: 1 VFKQPLSLHSTSPMTGFLRNGYCEVPSSDFGN 32 >ref|XP_013432373.1| hypothetical protein M436DRAFT_77521 [Aureobasidium namibiae CBS 147.97] gi|662520088|gb|KEQ77646.1| hypothetical protein M436DRAFT_77521 [Aureobasidium namibiae CBS 147.97] Length = 122 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -2 Query: 116 MSKSLNVFKQPLSLHSTSPMTGFLRNGYCEVPGSDYGN 3 MS+SLNV +PL++HSTSPMTG+LRNGYCEVP SD GN Sbjct: 1 MSRSLNVLSKPLAIHSTSPMTGYLRNGYCEVPASDAGN 38 >gb|KEQ67236.1| hypothetical protein M437DRAFT_79890 [Aureobasidium melanogenum CBS 110374] Length = 122 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -2 Query: 116 MSKSLNVFKQPLSLHSTSPMTGFLRNGYCEVPGSDYGN 3 MS+SLNV +PL++HSTSPMTG+LRNGYCEVP SD GN Sbjct: 1 MSRSLNVLSKPLAIHSTSPMTGYLRNGYCEVPASDAGN 38 >gb|KIW08815.1| hypothetical protein, variant [Verruconis gallopava] Length = 112 Score = 66.2 bits (160), Expect = 9e-09 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = -2 Query: 116 MSKSLNVFKQPLSLHSTSPMTGFLRNGYCEVPGSDYGN 3 M ++LNVFK+PL LHST PMTGFLR+GYC+VP SD+GN Sbjct: 4 MMRALNVFKRPLQLHSTRPMTGFLRDGYCKVPPSDFGN 41 >gb|KIW08814.1| hypothetical protein PV09_00746 [Verruconis gallopava] Length = 133 Score = 66.2 bits (160), Expect = 9e-09 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = -2 Query: 116 MSKSLNVFKQPLSLHSTSPMTGFLRNGYCEVPGSDYGN 3 M ++LNVFK+PL LHST PMTGFLR+GYC+VP SD+GN Sbjct: 4 MMRALNVFKRPLQLHSTRPMTGFLRDGYCKVPPSDFGN 41 >ref|XP_001935049.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187980997|gb|EDU47623.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 167 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -2 Query: 107 SLNVFKQPLSLHSTSPMTGFLRNGYCEVPGSDYGN 3 SLNVFKQPL+LHST P+TGF R GYCEVP SD GN Sbjct: 49 SLNVFKQPLALHSTQPLTGFTRTGYCEVPASDAGN 83 >ref|XP_008020428.1| hypothetical protein SETTUDRAFT_85840 [Setosphaeria turcica Et28A] gi|482814758|gb|EOA91433.1| hypothetical protein SETTUDRAFT_85840 [Setosphaeria turcica Et28A] Length = 165 Score = 63.5 bits (153), Expect = 6e-08 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -2 Query: 107 SLNVFKQPLSLHSTSPMTGFLRNGYCEVPGSDYGN 3 SLNVFKQPL+LHST P+TGF R GYCEVP SD GN Sbjct: 47 SLNVFKQPLALHSTQPLTGFTRTGYCEVPPSDAGN 81 >dbj|GAM90763.1| hypothetical protein ANO11243_088080 [fungal sp. No.11243] Length = 123 Score = 63.2 bits (152), Expect = 7e-08 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -2 Query: 116 MSKSLNVFKQPLSLHSTSPMTGFLRNGYCEVPGSDYGN 3 MSKSL+V + PL+LHSTSP+TGF R GYCEVP D+GN Sbjct: 1 MSKSLSVLRTPLALHSTSPITGFTRTGYCEVPAGDHGN 38 >ref|XP_001804409.1| hypothetical protein SNOG_14212 [Parastagonospora nodorum SN15] gi|111057329|gb|EAT78449.1| hypothetical protein SNOG_14212 [Parastagonospora nodorum SN15] Length = 161 Score = 63.2 bits (152), Expect = 7e-08 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -2 Query: 113 SKSLNVFKQPLSLHSTSPMTGFLRNGYCEVPGSDYGN 3 S SLNVFKQPL+LHST P+TGF+R GYCE P D GN Sbjct: 41 SMSLNVFKQPLALHSTKPLTGFMRTGYCEAPKQDLGN 77 >ref|XP_007692363.1| hypothetical protein COCMIDRAFT_40656 [Bipolaris oryzae ATCC 44560] gi|576927421|gb|EUC41108.1| hypothetical protein COCMIDRAFT_40656 [Bipolaris oryzae ATCC 44560] Length = 159 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -2 Query: 119 KMSKSLNVFKQPLSLHSTSPMTGFLRNGYCEVPGSDYGN 3 K + +LNVFKQPL+LHST P+TGF R GYCEVP SD GN Sbjct: 37 KGNMALNVFKQPLALHSTQPITGFTRTGYCEVPPSDAGN 75 >ref|XP_003299248.1| hypothetical protein PTT_10198 [Pyrenophora teres f. teres 0-1] gi|311327167|gb|EFQ92666.1| hypothetical protein PTT_10198 [Pyrenophora teres f. teres 0-1] Length = 166 Score = 62.8 bits (151), Expect = 1e-07 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = -2 Query: 107 SLNVFKQPLSLHSTSPMTGFLRNGYCEVPGSDYGN 3 S NVFKQPL+LHST P+TGF R GYCEVP SD GN Sbjct: 48 SFNVFKQPLALHSTQPLTGFTRTGYCEVPASDAGN 82 >ref|XP_007712198.1| hypothetical protein COCCADRAFT_95942 [Bipolaris zeicola 26-R-13] gi|576919298|gb|EUC33475.1| hypothetical protein COCCADRAFT_95942 [Bipolaris zeicola 26-R-13] Length = 165 Score = 62.4 bits (150), Expect = 1e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -2 Query: 107 SLNVFKQPLSLHSTSPMTGFLRNGYCEVPGSDYGN 3 +LNVFKQPL+LHST P+TGF R GYCEVP SD GN Sbjct: 47 ALNVFKQPLALHSTQPLTGFTRTGYCEVPPSDAGN 81 >ref|XP_007782430.1| hypothetical protein W97_06366 [Coniosporium apollinis CBS 100218] gi|494830588|gb|EON67113.1| hypothetical protein W97_06366 [Coniosporium apollinis CBS 100218] Length = 122 Score = 62.4 bits (150), Expect = 1e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -2 Query: 107 SLNVFKQPLSLHSTSPMTGFLRNGYCEVPGSDYGN 3 SLNVFK+PL+LHST PMTG+ RNGYCEVP D GN Sbjct: 3 SLNVFKKPLALHSTKPMTGYTRNGYCEVPPEDGGN 37 >ref|XP_014077955.1| hypothetical protein COCC4DRAFT_171808 [Bipolaris maydis ATCC 48331] gi|451994488|gb|EMD86958.1| hypothetical protein COCHEDRAFT_1023727 [Bipolaris maydis C5] gi|477586963|gb|ENI04046.1| hypothetical protein COCC4DRAFT_171808 [Bipolaris maydis ATCC 48331] Length = 164 Score = 62.4 bits (150), Expect = 1e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -2 Query: 107 SLNVFKQPLSLHSTSPMTGFLRNGYCEVPGSDYGN 3 +LNVFKQPL+LHST P+TGF R GYCEVP SD GN Sbjct: 46 ALNVFKQPLALHSTQPLTGFTRTGYCEVPPSDAGN 80