BLASTX nr result
ID: Cinnamomum24_contig00035844
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00035844 (229 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007780984.1| hypothetical protein W97_04906 [Coniosporium... 77 5e-12 ref|XP_003302259.1| hypothetical protein PTT_14008 [Pyrenophora ... 73 1e-10 ref|XP_013344061.1| hypothetical protein AUEXF2481DRAFT_4646 [Au... 71 4e-10 ref|XP_001932267.1| hypothetical protein PTRG_01934 [Pyrenophora... 71 4e-10 ref|XP_008027234.1| hypothetical protein SETTUDRAFT_163533 [Seto... 69 2e-09 gb|KNG46323.1| hypothetical protein TW65_86959 [Stemphylium lyco... 68 2e-09 gb|KEQ67609.1| hypothetical protein M437DRAFT_37063 [Aureobasidi... 68 2e-09 ref|XP_007582159.1| hypothetical protein UCRNP2_2860 [Neofusicoc... 67 4e-09 gb|EME45841.1| hypothetical protein DOTSEDRAFT_127401 [Dothistro... 67 4e-09 gb|KEQ81462.1| hypothetical protein M438DRAFT_347973 [Aureobasid... 67 5e-09 gb|EKG15085.1| hypothetical protein MPH_07768 [Macrophomina phas... 67 7e-09 ref|XP_013431839.1| hypothetical protein M436DRAFT_36398 [Aureob... 66 1e-08 ref|XP_014556562.1| hypothetical protein COCVIDRAFT_37868 [Bipol... 65 3e-08 ref|XP_007683913.1| hypothetical protein COCMIDRAFT_84161 [Bipol... 65 3e-08 ref|XP_007713901.1| hypothetical protein COCCADRAFT_100322 [Bipo... 65 3e-08 gb|KKY19632.1| hypothetical protein UCDDS831_g05291 [Diplodia se... 64 6e-08 ref|XP_014078109.1| hypothetical protein COCC4DRAFT_81826 [Bipol... 64 6e-08 ref|XP_007698157.1| hypothetical protein COCSADRAFT_198141 [Bipo... 63 8e-08 ref|XP_001805031.1| hypothetical protein SNOG_14861 [Parastagono... 63 8e-08 dbj|GAM88476.1| hypothetical protein ANO11243_065090 [fungal sp.... 62 1e-07 >ref|XP_007780984.1| hypothetical protein W97_04906 [Coniosporium apollinis CBS 100218] gi|494828909|gb|EON65667.1| hypothetical protein W97_04906 [Coniosporium apollinis CBS 100218] Length = 117 Score = 77.0 bits (188), Expect = 5e-12 Identities = 30/55 (54%), Positives = 45/55 (81%) Frame = -1 Query: 184 PNCAEFMSKYKKEDGGENVSELKVRWSTESRDPKVWPQSTIITEENVGAVLKLLD 20 PNC EFMSKYKK+ G ++++E+KVRWST R+ K WP +T +T++N+ AVLK+++ Sbjct: 41 PNCQEFMSKYKKKGGAQHITEMKVRWSTAGREAKTWPATTTVTQDNLEAVLKMVE 95 >ref|XP_003302259.1| hypothetical protein PTT_14008 [Pyrenophora teres f. teres 0-1] gi|311322487|gb|EFQ89641.1| hypothetical protein PTT_14008 [Pyrenophora teres f. teres 0-1] Length = 114 Score = 72.8 bits (177), Expect = 1e-10 Identities = 30/55 (54%), Positives = 44/55 (80%), Gaps = 1/55 (1%) Frame = -1 Query: 184 PNCAEFMSKYKKEDGG-ENVSELKVRWSTESRDPKVWPQSTIITEENVGAVLKLL 23 PNCAEFM+K+K DG E + E K+ W T++RD K+WP+ T++T+EN+GA+L+LL Sbjct: 43 PNCAEFMAKHKAADGPKEIIHEFKIHWDTKTRDSKIWPEYTVLTDENLGAILELL 97 >ref|XP_013344061.1| hypothetical protein AUEXF2481DRAFT_4646 [Aureobasidium subglaciale EXF-2481] gi|662538374|gb|KEQ95680.1| hypothetical protein AUEXF2481DRAFT_4646 [Aureobasidium subglaciale EXF-2481] Length = 140 Score = 70.9 bits (172), Expect = 4e-10 Identities = 34/62 (54%), Positives = 45/62 (72%), Gaps = 2/62 (3%) Frame = -1 Query: 181 NCAEFMSKYKKEDGGENVSELKVRWSTESRDPKVWPQSTIITEENVGAVLKL--LDPAKD 8 NCAE ++KYKK+ G E V+E+KVRWS + RD K +P++T++T EN AVL L L KD Sbjct: 45 NCAEALAKYKKQSGAEKVTEIKVRWSADGRDSKTFPKTTVLTGENCKAVLSLISLHGGKD 104 Query: 7 IL 2 IL Sbjct: 105 IL 106 >ref|XP_001932267.1| hypothetical protein PTRG_01934 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187973873|gb|EDU41372.1| hypothetical protein PTRG_01934 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 114 Score = 70.9 bits (172), Expect = 4e-10 Identities = 30/55 (54%), Positives = 43/55 (78%), Gaps = 1/55 (1%) Frame = -1 Query: 184 PNCAEFMSKYKKEDGG-ENVSELKVRWSTESRDPKVWPQSTIITEENVGAVLKLL 23 PNCAEFM+K+K DG E + E K+ W T++RD K+WP+ T++T+EN+GAV +LL Sbjct: 43 PNCAEFMAKHKAADGPKEIIHEFKIHWDTKTRDAKIWPEYTVLTDENLGAVSELL 97 >ref|XP_008027234.1| hypothetical protein SETTUDRAFT_163533 [Setosphaeria turcica Et28A] gi|482807718|gb|EOA84651.1| hypothetical protein SETTUDRAFT_163533 [Setosphaeria turcica Et28A] Length = 118 Score = 68.6 bits (166), Expect = 2e-09 Identities = 27/55 (49%), Positives = 43/55 (78%), Gaps = 1/55 (1%) Frame = -1 Query: 184 PNCAEFMSKYKKEDG-GENVSELKVRWSTESRDPKVWPQSTIITEENVGAVLKLL 23 PNCAEFM+K+K +DG E++ E ++ W T+ RD K+WP+ TI+T++N A+L++L Sbjct: 47 PNCAEFMAKHKAKDGPAEHIKEFRLHWDTKGRDAKIWPEYTIVTDDNFAALLEVL 101 >gb|KNG46323.1| hypothetical protein TW65_86959 [Stemphylium lycopersici] Length = 115 Score = 68.2 bits (165), Expect = 2e-09 Identities = 26/55 (47%), Positives = 41/55 (74%), Gaps = 1/55 (1%) Frame = -1 Query: 184 PNCAEFMSKYKKEDG-GENVSELKVRWSTESRDPKVWPQSTIITEENVGAVLKLL 23 PNCAEFM+++K DG E + E ++ W T++RD K+WP+ T++T+ N GA+ +LL Sbjct: 44 PNCAEFMAQHKANDGPAEQIQEFRIHWDTKTRDAKIWPEYTVLTDANFGAIFELL 98 >gb|KEQ67609.1| hypothetical protein M437DRAFT_37063 [Aureobasidium melanogenum CBS 110374] Length = 127 Score = 68.2 bits (165), Expect = 2e-09 Identities = 32/62 (51%), Positives = 46/62 (74%), Gaps = 2/62 (3%) Frame = -1 Query: 181 NCAEFMSKYKKEDGGENVSELKVRWSTESRDPKVWPQSTIITEENVGAVLKL--LDPAKD 8 NCAE ++KYKK+ E V+E+KVRW+ E RD K++P++T++T EN A+L L L AKD Sbjct: 44 NCAEALAKYKKKGEAEKVTEIKVRWAAEGRDSKLFPKTTVLTGENCKAILSLISLHGAKD 103 Query: 7 IL 2 +L Sbjct: 104 VL 105 >ref|XP_007582159.1| hypothetical protein UCRNP2_2860 [Neofusicoccum parvum UCRNP2] gi|485925925|gb|EOD50365.1| hypothetical protein UCRNP2_2860 [Neofusicoccum parvum UCRNP2] Length = 123 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/64 (48%), Positives = 44/64 (68%), Gaps = 3/64 (4%) Frame = -1 Query: 184 PNCAEFMSKYKKEDGGENVSELKVRWSTESRDPKVWPQSTIITEENVGAVLKLLDPA--- 14 PNC EFM+KY K+ G E V +KVRW+ RD K +P +T++TE+NV A L L++ + Sbjct: 42 PNCQEFMAKYAKKKGPEKVEAIKVRWAMAGRDHKTFPGTTVLTEDNVKAALSLIEKSGIG 101 Query: 13 KDIL 2 KD+L Sbjct: 102 KDVL 105 >gb|EME45841.1| hypothetical protein DOTSEDRAFT_127401 [Dothistroma septosporum NZE10] Length = 139 Score = 67.4 bits (163), Expect = 4e-09 Identities = 26/54 (48%), Positives = 43/54 (79%) Frame = -1 Query: 184 PNCAEFMSKYKKEDGGENVSELKVRWSTESRDPKVWPQSTIITEENVGAVLKLL 23 PNCAE +SKYK ++ + VSE+KV+W++E RD ++W + T++T++N AVL+L+ Sbjct: 44 PNCAEVLSKYKSKESKDTVSEVKVKWASEGRDKQLWVKDTLLTDDNAEAVLRLM 97 >gb|KEQ81462.1| hypothetical protein M438DRAFT_347973 [Aureobasidium pullulans EXF-150] Length = 130 Score = 67.0 bits (162), Expect = 5e-09 Identities = 33/62 (53%), Positives = 44/62 (70%), Gaps = 2/62 (3%) Frame = -1 Query: 181 NCAEFMSKYKKEDGGENVSELKVRWSTESRDPKVWPQSTIITEENVGAVLKL--LDPAKD 8 NCAE ++KYKK E V+E+KVRW+ E RD K++P++T++T EN AVL L L KD Sbjct: 45 NCAEALAKYKKSKEAEKVTEIKVRWAAEGRDSKLFPKATVLTGENCKAVLSLISLHGGKD 104 Query: 7 IL 2 IL Sbjct: 105 IL 106 >gb|EKG15085.1| hypothetical protein MPH_07768 [Macrophomina phaseolina MS6] Length = 126 Score = 66.6 bits (161), Expect = 7e-09 Identities = 29/64 (45%), Positives = 45/64 (70%), Gaps = 3/64 (4%) Frame = -1 Query: 184 PNCAEFMSKYKKEDGGENVSELKVRWSTESRDPKVWPQSTIITEENVGAVLKLLDPA--- 14 PNC EFM+KY K+ G ++V +KVRW+ RD K +P ST++T++N+ A L L++ + Sbjct: 42 PNCQEFMAKYAKKKGPQHVESIKVRWAMAGRDHKTFPGSTVLTDDNIEAALSLIEKSGVG 101 Query: 13 KDIL 2 KD+L Sbjct: 102 KDVL 105 >ref|XP_013431839.1| hypothetical protein M436DRAFT_36398 [Aureobasidium namibiae CBS 147.97] gi|662520399|gb|KEQ77957.1| hypothetical protein M436DRAFT_36398 [Aureobasidium namibiae CBS 147.97] Length = 128 Score = 65.9 bits (159), Expect = 1e-08 Identities = 32/62 (51%), Positives = 44/62 (70%), Gaps = 2/62 (3%) Frame = -1 Query: 181 NCAEFMSKYKKEDGGENVSELKVRWSTESRDPKVWPQSTIITEENVGAVLKL--LDPAKD 8 NCAE ++KYKK+ E V+E+KVRW+ E RD K++P++T +T EN AVL L L KD Sbjct: 45 NCAEALAKYKKKSEAEKVTEIKVRWAAEGRDSKLFPKTTTLTGENCKAVLSLISLHGGKD 104 Query: 7 IL 2 +L Sbjct: 105 VL 106 >ref|XP_014556562.1| hypothetical protein COCVIDRAFT_37868 [Bipolaris victoriae FI3] gi|578489541|gb|EUN26967.1| hypothetical protein COCVIDRAFT_37868 [Bipolaris victoriae FI3] Length = 116 Score = 64.7 bits (156), Expect = 3e-08 Identities = 27/55 (49%), Positives = 42/55 (76%), Gaps = 1/55 (1%) Frame = -1 Query: 184 PNCAEFMSKYKKEDG-GENVSELKVRWSTESRDPKVWPQSTIITEENVGAVLKLL 23 PNCAEFM+K+K +DG E + E K+ W + R+ K+WP+ T++TE+N+ AV++LL Sbjct: 46 PNCAEFMAKHKAKDGPAEQIQEFKIHWDVKGRE-KLWPEYTVLTEDNISAVVELL 99 >ref|XP_007683913.1| hypothetical protein COCMIDRAFT_84161 [Bipolaris oryzae ATCC 44560] gi|576936124|gb|EUC49622.1| hypothetical protein COCMIDRAFT_84161 [Bipolaris oryzae ATCC 44560] Length = 116 Score = 64.7 bits (156), Expect = 3e-08 Identities = 27/55 (49%), Positives = 42/55 (76%), Gaps = 1/55 (1%) Frame = -1 Query: 184 PNCAEFMSKYKKEDG-GENVSELKVRWSTESRDPKVWPQSTIITEENVGAVLKLL 23 PNCAEFM+K+K +DG E + E K+ W + R+ K+WP+ T++TE+N+ AV++LL Sbjct: 47 PNCAEFMAKHKAKDGPAEQIQEFKIHWDVKGRE-KLWPEYTVLTEDNISAVVELL 100 >ref|XP_007713901.1| hypothetical protein COCCADRAFT_100322 [Bipolaris zeicola 26-R-13] gi|576917606|gb|EUC31824.1| hypothetical protein COCCADRAFT_100322 [Bipolaris zeicola 26-R-13] Length = 117 Score = 64.7 bits (156), Expect = 3e-08 Identities = 27/55 (49%), Positives = 42/55 (76%), Gaps = 1/55 (1%) Frame = -1 Query: 184 PNCAEFMSKYKKEDG-GENVSELKVRWSTESRDPKVWPQSTIITEENVGAVLKLL 23 PNCAEFM+K+K +DG E + E K+ W + R+ K+WP+ T++TE+N+ AV++LL Sbjct: 47 PNCAEFMAKHKAKDGPAEQIQEFKIHWDVKGRE-KLWPEYTVLTEDNISAVVELL 100 >gb|KKY19632.1| hypothetical protein UCDDS831_g05291 [Diplodia seriata] Length = 119 Score = 63.5 bits (153), Expect = 6e-08 Identities = 30/66 (45%), Positives = 45/66 (68%), Gaps = 5/66 (7%) Frame = -1 Query: 184 PNCAEFMSKYKKEDGGENVSELKVRWS--TESRDPKVWPQSTIITEENVGAVLKLLDPA- 14 PNC EFM+KY K+ G + V +KVRW+ RD K++P +T +T++NV AVL L++ + Sbjct: 42 PNCQEFMAKYAKKKGNQKVESVKVRWAMGASGRDHKIFPSTTTLTDDNVAAVLALIERSG 101 Query: 13 --KDIL 2 KD+L Sbjct: 102 VGKDVL 107 >ref|XP_014078109.1| hypothetical protein COCC4DRAFT_81826 [Bipolaris maydis ATCC 48331] gi|452004887|gb|EMD97343.1| hypothetical protein COCHEDRAFT_1124748, partial [Bipolaris maydis C5] gi|477587118|gb|ENI04200.1| hypothetical protein COCC4DRAFT_81826 [Bipolaris maydis ATCC 48331] Length = 116 Score = 63.5 bits (153), Expect = 6e-08 Identities = 27/64 (42%), Positives = 44/64 (68%), Gaps = 3/64 (4%) Frame = -1 Query: 184 PNCAEFMSKYKKEDG-GENVSELKVRWSTESRDPKVWPQSTIITEENVGAVLKLL--DPA 14 PNC EFM+K+K +DG E + E K+ W + R+ K+WP+ T++TEEN+ ++++L DP Sbjct: 46 PNCTEFMAKHKAQDGPAEQIQEFKIHWDVKGRE-KIWPEYTVLTEENIKVIVQMLKADPR 104 Query: 13 KDIL 2 +L Sbjct: 105 MGVL 108 >ref|XP_007698157.1| hypothetical protein COCSADRAFT_198141 [Bipolaris sorokiniana ND90Pr] gi|451853457|gb|EMD66751.1| hypothetical protein COCSADRAFT_198141 [Bipolaris sorokiniana ND90Pr] Length = 117 Score = 63.2 bits (152), Expect = 8e-08 Identities = 26/55 (47%), Positives = 41/55 (74%), Gaps = 1/55 (1%) Frame = -1 Query: 184 PNCAEFMSKYKKEDG-GENVSELKVRWSTESRDPKVWPQSTIITEENVGAVLKLL 23 PNC EFM+K+K +DG E + E K+ W + R+ K+WP+ T++TE+N+ AV++LL Sbjct: 47 PNCTEFMAKHKAKDGPAEQIQEFKIHWDVKGRE-KLWPEYTVLTEDNISAVVELL 100 >ref|XP_001805031.1| hypothetical protein SNOG_14861 [Parastagonospora nodorum SN15] gi|160704943|gb|EAT77713.2| hypothetical protein SNOG_14861 [Parastagonospora nodorum SN15] Length = 1210 Score = 63.2 bits (152), Expect = 8e-08 Identities = 26/63 (41%), Positives = 43/63 (68%), Gaps = 2/63 (3%) Frame = -1 Query: 184 PNCAEFMSKYKKEDGGENVSELKVRWSTESRDPKVWPQSTIITEENVGAVLKLL--DPAK 11 PNCAE MS++K + E + E K+ W ++RD K+WP+ T++ E N+ AV+++L P + Sbjct: 1140 PNCAEPMSQHKNPETKEQIQEFKIHWDRQARDGKIWPEYTVVHEGNLEAVVEMLKVSPGR 1199 Query: 10 DIL 2 D+L Sbjct: 1200 DVL 1202 >dbj|GAM88476.1| hypothetical protein ANO11243_065090 [fungal sp. No.11243] Length = 131 Score = 62.4 bits (150), Expect = 1e-07 Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 2/63 (3%) Frame = -1 Query: 184 PNCAEFMSKYKKEDGGENVSELKVRWSTESRDPKVWPQSTIITEENVGAVLKL--LDPAK 11 PNC E ++KY K+ V KVRWS E R+ ++WP ST +T+ENV AVL+L L K Sbjct: 47 PNCVEALAKYSKKKTTLQVKGFKVRWSGEPREARLWPSSTQLTDENVEAVLRLMALHQGK 106 Query: 10 DIL 2 DI+ Sbjct: 107 DII 109