BLASTX nr result
ID: Cinnamomum24_contig00035746
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00035746 (321 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007724251.1| large subunit ribosomal protein L29e [Capron... 107 3e-21 ref|XP_007931347.1| hypothetical protein MYCFIDRAFT_65593 [Pseud... 107 3e-21 gb|KIW00840.1| 60S ribosomal protein L29 [Verruconis gallopava] 106 8e-21 ref|XP_007784263.1| 60S ribosomal protein L29 [Coniosporium apol... 106 8e-21 gb|EME39946.1| hypothetical protein DOTSEDRAFT_47443 [Dothistrom... 106 8e-21 ref|XP_007673417.1| hypothetical protein BAUCODRAFT_119538 [Baud... 106 8e-21 ref|XP_013316829.1| 60S ribosomal protein L29 [Exophiala xenobio... 105 1e-20 ref|XP_003171468.1| 60S ribosomal protein L29 [Microsporum gypse... 105 2e-20 ref|XP_002846081.1| 60S ribosomal protein L29 [Arthroderma otae ... 105 2e-20 ref|XP_001805871.1| hypothetical protein SNOG_15733 [Parastagono... 105 2e-20 gb|KIW48209.1| 60S ribosomal protein L29 [Exophiala oligosperma] 104 2e-20 gb|EMF08841.1| hypothetical protein SEPMUDRAFT_151754 [Sphaeruli... 104 2e-20 ref|XP_003848719.1| 60S ribosomal protein L29 [Zymoseptoria trit... 104 2e-20 ref|XP_003303931.1| 60S ribosomal protein L29 [Pyrenophora teres... 103 4e-20 ref|XP_001936717.1| conserved hypothetical protein [Pyrenophora ... 103 4e-20 gb|EEH16090.2| 60S ribosomal protein L29 [Paracoccidioides brasi... 103 5e-20 ref|XP_010763039.1| 60S ribosomal protein L29 [Paracoccidioides ... 103 5e-20 gb|KEQ67129.1| hypothetical protein M437DRAFT_79786 [Aureobasidi... 103 5e-20 gb|EEH11222.1| conserved hypothetical protein [Histoplasma capsu... 103 5e-20 ref|XP_002792319.1| 60S ribosomal protein L29 [Paracoccidioides ... 103 5e-20 >ref|XP_007724251.1| large subunit ribosomal protein L29e [Capronia coronata CBS 617.96] gi|590013042|gb|EXJ88245.1| large subunit ribosomal protein L29e [Capronia coronata CBS 617.96] Length = 121 Score = 107 bits (267), Expect = 3e-21 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -2 Query: 320 HKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDAA 174 HKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDAA Sbjct: 73 HKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDAA 121 >ref|XP_007931347.1| hypothetical protein MYCFIDRAFT_65593 [Pseudocercospora fijiensis CIRAD86] gi|452977967|gb|EME77731.1| hypothetical protein MYCFIDRAFT_65593 [Pseudocercospora fijiensis CIRAD86] Length = 65 Score = 107 bits (267), Expect = 3e-21 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -2 Query: 320 HKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDAA 174 HKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDAA Sbjct: 17 HKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDAA 65 >gb|KIW00840.1| 60S ribosomal protein L29 [Verruconis gallopava] Length = 65 Score = 106 bits (264), Expect = 8e-21 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -2 Query: 320 HKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDAA 174 HKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTM+ALKEVKEGKRDAA Sbjct: 17 HKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKRDAA 65 >ref|XP_007784263.1| 60S ribosomal protein L29 [Coniosporium apollinis CBS 100218] gi|494832780|gb|EON68946.1| 60S ribosomal protein L29 [Coniosporium apollinis CBS 100218] Length = 65 Score = 106 bits (264), Expect = 8e-21 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -2 Query: 320 HKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDAA 174 HKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTM+ALKEVKEGKRDAA Sbjct: 17 HKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKRDAA 65 >gb|EME39946.1| hypothetical protein DOTSEDRAFT_47443 [Dothistroma septosporum NZE10] Length = 65 Score = 106 bits (264), Expect = 8e-21 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -2 Query: 320 HKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDAA 174 H+NGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDAA Sbjct: 17 HRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDAA 65 >ref|XP_007673417.1| hypothetical protein BAUCODRAFT_119538 [Baudoinia panamericana UAMH 10762] gi|449303971|gb|EMC99978.1| hypothetical protein BAUCODRAFT_119538 [Baudoinia panamericana UAMH 10762] Length = 65 Score = 106 bits (264), Expect = 8e-21 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -2 Query: 320 HKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDAA 174 HKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTM+ALKEVKEGKRDAA Sbjct: 17 HKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKRDAA 65 >ref|XP_013316829.1| 60S ribosomal protein L29 [Exophiala xenobiotica] gi|759279741|gb|KIW56245.1| 60S ribosomal protein L29 [Exophiala xenobiotica] Length = 75 Score = 105 bits (263), Expect = 1e-20 Identities = 48/49 (97%), Positives = 48/49 (97%) Frame = -2 Query: 320 HKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDAA 174 HKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRD A Sbjct: 27 HKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDTA 75 >ref|XP_003171468.1| 60S ribosomal protein L29 [Microsporum gypseum CBS 118893] gi|311343811|gb|EFR03014.1| 60S ribosomal protein L29 [Microsporum gypseum CBS 118893] Length = 65 Score = 105 bits (261), Expect = 2e-20 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = -2 Query: 320 HKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDAA 174 H+NGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRD+A Sbjct: 17 HRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDSA 65 >ref|XP_002846081.1| 60S ribosomal protein L29 [Arthroderma otae CBS 113480] gi|238843469|gb|EEQ33131.1| conserved hypothetical protein [Arthroderma otae CBS 113480] gi|326476329|gb|EGE00339.1| 60S ribosomal protein L29 [Trichophyton tonsurans CBS 112818] gi|607892685|gb|EZF32010.1| 60S ribosomal protein L29 [Trichophyton interdigitale H6] gi|607943201|gb|EZF76196.1| 60S ribosomal protein L29 [Trichophyton soudanense CBS 452.61] gi|607979708|gb|EZG08705.1| 60S ribosomal protein L29 [Trichophyton rubrum CBS 735.88] gi|633050504|gb|KDB26484.1| 60S ribosomal protein L29 [Trichophyton interdigitale MR816] Length = 65 Score = 105 bits (261), Expect = 2e-20 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = -2 Query: 320 HKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDAA 174 H+NGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRD+A Sbjct: 17 HRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDSA 65 >ref|XP_001805871.1| hypothetical protein SNOG_15733 [Parastagonospora nodorum SN15] gi|160705566|gb|EAT76828.2| hypothetical protein SNOG_15733 [Parastagonospora nodorum SN15] Length = 65 Score = 105 bits (261), Expect = 2e-20 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = -2 Query: 320 HKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDAA 174 H+NGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRD+A Sbjct: 17 HRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDSA 65 >gb|KIW48209.1| 60S ribosomal protein L29 [Exophiala oligosperma] Length = 113 Score = 104 bits (260), Expect = 2e-20 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -2 Query: 320 HKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDA 177 H+NGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDA Sbjct: 65 HRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDA 112 >gb|EMF08841.1| hypothetical protein SEPMUDRAFT_151754 [Sphaerulina musiva SO2202] Length = 65 Score = 104 bits (260), Expect = 2e-20 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -2 Query: 320 HKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDAA 174 HKNGIKKPKT+RYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDAA Sbjct: 17 HKNGIKKPKTNRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDAA 65 >ref|XP_003848719.1| 60S ribosomal protein L29 [Zymoseptoria tritici IPO323] gi|339468594|gb|EGP83695.1| hypothetical protein MYCGRDRAFT_82510 [Zymoseptoria tritici IPO323] gi|796711765|gb|KJY02244.1| 60S ribosomal protein L29 [Zymoseptoria brevis] Length = 65 Score = 104 bits (260), Expect = 2e-20 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -2 Query: 320 HKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDAA 174 HKNGIKKPKT+RYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDAA Sbjct: 17 HKNGIKKPKTNRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDAA 65 >ref|XP_003303931.1| 60S ribosomal protein L29 [Pyrenophora teres f. teres 0-1] gi|311319731|gb|EFQ87950.1| hypothetical protein PTT_16333 [Pyrenophora teres f. teres 0-1] Length = 65 Score = 103 bits (258), Expect = 4e-20 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -2 Query: 320 HKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDAA 174 H+NGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTM+ALKEVKEGKRD+A Sbjct: 17 HRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKRDSA 65 >ref|XP_001936717.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187983816|gb|EDU49304.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 111 Score = 103 bits (258), Expect = 4e-20 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -2 Query: 320 HKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDAA 174 H+NGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTM+ALKEVKEGKRD+A Sbjct: 63 HRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKRDSA 111 >gb|EEH16090.2| 60S ribosomal protein L29 [Paracoccidioides brasiliensis Pb03] Length = 92 Score = 103 bits (257), Expect = 5e-20 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -2 Query: 320 HKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDAA 174 H+NGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKR++A Sbjct: 44 HRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRESA 92 >ref|XP_010763039.1| 60S ribosomal protein L29 [Paracoccidioides brasiliensis Pb18] gi|699748565|gb|EEH42970.2| 60S ribosomal protein L29 [Paracoccidioides brasiliensis Pb18] Length = 92 Score = 103 bits (257), Expect = 5e-20 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -2 Query: 320 HKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDAA 174 H+NGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKR++A Sbjct: 44 HRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRESA 92 >gb|KEQ67129.1| hypothetical protein M437DRAFT_79786 [Aureobasidium melanogenum CBS 110374] gi|662522734|gb|KEQ80132.1| hypothetical protein M438DRAFT_339199 [Aureobasidium pullulans EXF-150] Length = 65 Score = 103 bits (257), Expect = 5e-20 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -2 Query: 320 HKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDAA 174 HKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTM+ALKEVKEGKR++A Sbjct: 17 HKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEGKRESA 65 >gb|EEH11222.1| conserved hypothetical protein [Histoplasma capsulatum G186AR] gi|240279767|gb|EER43272.1| conserved hypothetical protein [Histoplasma capsulatum H143] gi|325092897|gb|EGC46207.1| conserved hypothetical protein [Histoplasma capsulatum H88] Length = 65 Score = 103 bits (257), Expect = 5e-20 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -2 Query: 320 HKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDAA 174 H+NGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKR++A Sbjct: 17 HRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRESA 65 >ref|XP_002792319.1| 60S ribosomal protein L29 [Paracoccidioides lutzii Pb01] gi|226278989|gb|EEH34555.1| hypothetical protein PAAG_05604 [Paracoccidioides lutzii Pb01] Length = 65 Score = 103 bits (257), Expect = 5e-20 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -2 Query: 320 HKNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDAA 174 H+NGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKR++A Sbjct: 17 HRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRESA 65