BLASTX nr result
ID: Cinnamomum24_contig00035735
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00035735 (470 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME44058.1| hypothetical protein DOTSEDRAFT_71757 [Dothistrom... 75 3e-11 >gb|EME44058.1| hypothetical protein DOTSEDRAFT_71757 [Dothistroma septosporum NZE10] Length = 253 Score = 74.7 bits (182), Expect = 3e-11 Identities = 33/52 (63%), Positives = 41/52 (78%) Frame = -2 Query: 466 EEFSTAARHAEHEADHQYMDTNGLAHFAASDYMAEIHSILYDVYLVDEPAWI 311 EEFS A R AE +AD YM T+ LAHF ASDY+AEIHS++YD +L +EP+WI Sbjct: 202 EEFSHAVRDAEADADATYMTTHDLAHFGASDYLAEIHSLIYDTFLAEEPSWI 253