BLASTX nr result
ID: Cinnamomum24_contig00035703
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00035703 (208 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH56321.1| hypothetical protein GLYMA_06G317400 [Glycine max] 111 2e-22 gb|KRH56320.1| hypothetical protein GLYMA_06G317400 [Glycine max] 111 2e-22 gb|KHN42782.1| 60S ribosomal protein L11 [Glycine soja] gi|94710... 111 2e-22 gb|AFP44117.1| 60S ribosomal protein [Lycoris longituba] 111 2e-22 ref|NP_001242757.1| uncharacterized protein LOC100778713 [Glycin... 111 2e-22 ref|XP_007025337.1| Ribosomal protein large subunit 16A [Theobro... 110 3e-22 ref|XP_014523952.1| PREDICTED: 60S ribosomal protein L11 [Vigna ... 110 4e-22 ref|XP_014499621.1| PREDICTED: 60S ribosomal protein L11-like [V... 110 4e-22 gb|KRH13276.1| hypothetical protein GLYMA_15G227600 [Glycine max] 110 4e-22 ref|XP_013616324.1| PREDICTED: 60S ribosomal protein L11-1-like ... 110 4e-22 ref|NP_001266161.1| 60S ribosomal protein L11-like [Cicer arieti... 110 4e-22 ref|NP_191429.1| 60S ribosomal protein L11-2 [Arabidopsis thalia... 110 4e-22 sp|P46287.1|RL11_MEDSA RecName: Full=60S ribosomal protein L11; ... 110 4e-22 ref|NP_850376.2| 60S ribosomal protein L16A [Arabidopsis thalian... 110 4e-22 ref|XP_012447299.1| PREDICTED: 60S ribosomal protein L11 [Gossyp... 110 4e-22 gb|KJB57390.1| hypothetical protein B456_009G161300 [Gossypium r... 110 4e-22 ref|XP_011082984.1| PREDICTED: 60S ribosomal protein L11 [Sesamu... 110 4e-22 ref|XP_011081868.1| PREDICTED: 60S ribosomal protein L11-like [S... 110 4e-22 ref|XP_011088013.1| PREDICTED: 60S ribosomal protein L11-like [S... 110 4e-22 ref|XP_011039398.1| PREDICTED: 60S ribosomal protein L11 [Populu... 110 4e-22 >gb|KRH56321.1| hypothetical protein GLYMA_06G317400 [Glycine max] Length = 175 Score = 111 bits (278), Expect = 2e-22 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +1 Query: 34 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRS 207 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRS Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRS 58 >gb|KRH56320.1| hypothetical protein GLYMA_06G317400 [Glycine max] Length = 199 Score = 111 bits (278), Expect = 2e-22 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +1 Query: 34 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRS 207 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRS Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRS 58 >gb|KHN42782.1| 60S ribosomal protein L11 [Glycine soja] gi|947107939|gb|KRH56322.1| hypothetical protein GLYMA_06G317400 [Glycine max] Length = 181 Score = 111 bits (278), Expect = 2e-22 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +1 Query: 34 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRS 207 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRS Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRS 58 >gb|AFP44117.1| 60S ribosomal protein [Lycoris longituba] Length = 182 Score = 111 bits (278), Expect = 2e-22 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +1 Query: 34 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRS 207 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRS Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRS 58 >ref|NP_001242757.1| uncharacterized protein LOC100778713 [Glycine max] gi|255627001|gb|ACU13845.1| unknown [Glycine max] Length = 181 Score = 111 bits (278), Expect = 2e-22 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +1 Query: 34 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRS 207 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRS Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRS 58 >ref|XP_007025337.1| Ribosomal protein large subunit 16A [Theobroma cacao] gi|508780703|gb|EOY27959.1| Ribosomal protein large subunit 16A [Theobroma cacao] Length = 257 Score = 110 bits (276), Expect = 3e-22 Identities = 57/60 (95%), Positives = 59/60 (98%) Frame = +1 Query: 28 FPMASEKKLSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRS 207 F MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRS Sbjct: 74 FAMASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRS 133 >ref|XP_014523952.1| PREDICTED: 60S ribosomal protein L11 [Vigna radiata var. radiata] gi|951070651|ref|XP_014490853.1| PREDICTED: 60S ribosomal protein L11 [Vigna radiata var. radiata] Length = 181 Score = 110 bits (275), Expect = 4e-22 Identities = 57/58 (98%), Positives = 58/58 (100%) Frame = +1 Query: 34 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRS 207 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRS Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRS 58 >ref|XP_014499621.1| PREDICTED: 60S ribosomal protein L11-like [Vigna radiata var. radiata] Length = 181 Score = 110 bits (275), Expect = 4e-22 Identities = 57/58 (98%), Positives = 58/58 (100%) Frame = +1 Query: 34 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRS 207 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRS Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRS 58 >gb|KRH13276.1| hypothetical protein GLYMA_15G227600 [Glycine max] Length = 169 Score = 110 bits (275), Expect = 4e-22 Identities = 57/58 (98%), Positives = 58/58 (100%) Frame = +1 Query: 34 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRS 207 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRS Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRS 58 >ref|XP_013616324.1| PREDICTED: 60S ribosomal protein L11-1-like [Brassica oleracea var. oleracea] gi|923678309|ref|XP_013652766.1| PREDICTED: 60S ribosomal protein L11-1-like [Brassica napus] gi|923761399|ref|XP_013677181.1| PREDICTED: 60S ribosomal protein L11-1-like [Brassica napus] Length = 182 Score = 110 bits (275), Expect = 4e-22 Identities = 57/58 (98%), Positives = 58/58 (100%) Frame = +1 Query: 34 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRS 207 MASEKKLSNPMR+IKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRS Sbjct: 1 MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRS 58 >ref|NP_001266161.1| 60S ribosomal protein L11-like [Cicer arietinum] gi|502156356|ref|XP_004510433.1| PREDICTED: 60S ribosomal protein L11-like [Cicer arietinum] gi|502158502|ref|XP_004511177.1| PREDICTED: 60S ribosomal protein L11-like [Cicer arietinum] gi|24817256|emb|CAD56220.1| ribosomal protein RL5 [Cicer arietinum] Length = 181 Score = 110 bits (275), Expect = 4e-22 Identities = 57/58 (98%), Positives = 58/58 (100%) Frame = +1 Query: 34 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRS 207 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRS Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRS 58 >ref|NP_191429.1| 60S ribosomal protein L11-2 [Arabidopsis thaliana] gi|18415161|ref|NP_567563.1| 60S ribosomal protein L11-2 [Arabidopsis thaliana] gi|30694822|ref|NP_568649.2| 60S ribosomal protein L11-2 [Arabidopsis thaliana] gi|27735235|sp|P42794.2|RL112_ARATH RecName: Full=60S ribosomal protein L11-2; AltName: Full=L16 gi|11908058|gb|AAG41458.1|AF326876_1 putative ribosomal protein L11 [Arabidopsis thaliana] gi|12642874|gb|AAK00379.1|AF339697_1 putative ribosomal protein L11 [Arabidopsis thaliana] gi|14326537|gb|AAK60313.1|AF385722_1 AT4g18730/F28A21_140 [Arabidopsis thaliana] gi|7630065|emb|CAB88287.1| ribosomal protein L11-like [Arabidopsis thaliana] gi|9758681|dbj|BAB09220.1| ribosomal protein L11-like [Arabidopsis thaliana] gi|14517470|gb|AAK62625.1| AT4g18730/F28A21_140 [Arabidopsis thaliana] gi|18700224|gb|AAL77722.1| AT4g18730/F28A21_140 [Arabidopsis thaliana] gi|21553372|gb|AAM62465.1| ribosomal protein L11, cytosolic [Arabidopsis thaliana] gi|21592421|gb|AAM64372.1| ribosomal protein L11, cytosolic [Arabidopsis thaliana] gi|22136574|gb|AAM91073.1| AT4g18730/F28A21_140 [Arabidopsis thaliana] gi|332007914|gb|AED95297.1| 60S ribosomal protein L11-2 [Arabidopsis thaliana] gi|332646298|gb|AEE79819.1| 60S ribosomal protein L11-2 [Arabidopsis thaliana] gi|332658682|gb|AEE84082.1| 60S ribosomal protein L11-2 [Arabidopsis thaliana] Length = 182 Score = 110 bits (275), Expect = 4e-22 Identities = 57/58 (98%), Positives = 58/58 (100%) Frame = +1 Query: 34 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRS 207 MASEKKLSNPMR+IKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRS Sbjct: 1 MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRS 58 >sp|P46287.1|RL11_MEDSA RecName: Full=60S ribosomal protein L11; AltName: Full=L5 gi|463252|emb|CAA55090.1| RL5 ribosomal protein [Medicago sativa] Length = 181 Score = 110 bits (275), Expect = 4e-22 Identities = 57/58 (98%), Positives = 58/58 (100%) Frame = +1 Query: 34 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRS 207 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRS Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRS 58 >ref|NP_850376.2| 60S ribosomal protein L16A [Arabidopsis thaliana] gi|297791141|ref|XP_002863455.1| 60S ribosomal protein L11 [Arabidopsis lyrata subsp. lyrata] gi|297804282|ref|XP_002870025.1| 60S ribosomal protein L11 [Arabidopsis lyrata subsp. lyrata] gi|565435085|ref|XP_006281176.1| hypothetical protein CARUB_v10027211mg [Capsella rubella] gi|565468062|ref|XP_006291911.1| hypothetical protein CARUB_v10018095mg [Capsella rubella] gi|727446519|ref|XP_010504827.1| PREDICTED: 60S ribosomal protein L11-1 [Camelina sativa] gi|727529403|ref|XP_010439816.1| PREDICTED: 60S ribosomal protein L11-1 isoform X2 [Camelina sativa] gi|727534652|ref|XP_010441671.1| PREDICTED: 60S ribosomal protein L11-1 [Camelina sativa] gi|727554532|ref|XP_010449473.1| PREDICTED: 60S ribosomal protein L11-1 isoform X2 [Camelina sativa] gi|727621381|ref|XP_010481534.1| PREDICTED: 60S ribosomal protein L11-1 [Camelina sativa] gi|727648322|ref|XP_010494724.1| PREDICTED: 60S ribosomal protein L11-1 [Camelina sativa] gi|727652313|ref|XP_010496881.1| PREDICTED: 60S ribosomal protein L11-1 isoform X2 [Camelina sativa] gi|21542441|sp|P42795.2|RL111_ARATH RecName: Full=60S ribosomal protein L11-1; AltName: Full=L16A gi|110737006|dbj|BAF00458.1| 60S ribosomal protein L11B [Arabidopsis thaliana] gi|297309290|gb|EFH39714.1| 60S ribosomal protein L11 [Arabidopsis lyrata subsp. lyrata] gi|297315861|gb|EFH46284.1| 60S ribosomal protein L11 [Arabidopsis lyrata subsp. lyrata] gi|330255069|gb|AEC10163.1| 60S ribosomal protein L11-1/L16A [Arabidopsis thaliana] gi|482549880|gb|EOA14074.1| hypothetical protein CARUB_v10027211mg [Capsella rubella] gi|482560618|gb|EOA24809.1| hypothetical protein CARUB_v10018095mg [Capsella rubella] Length = 182 Score = 110 bits (275), Expect = 4e-22 Identities = 57/58 (98%), Positives = 58/58 (100%) Frame = +1 Query: 34 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRS 207 MASEKKLSNPMR+IKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRS Sbjct: 1 MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRS 58 >ref|XP_012447299.1| PREDICTED: 60S ribosomal protein L11 [Gossypium raimondii] gi|823234409|ref|XP_012449841.1| PREDICTED: 60S ribosomal protein L11 [Gossypium raimondii] gi|823236877|ref|XP_012451094.1| PREDICTED: 60S ribosomal protein L11 [Gossypium raimondii] gi|823248711|ref|XP_012457012.1| PREDICTED: 60S ribosomal protein L11 [Gossypium raimondii] gi|763790395|gb|KJB57391.1| hypothetical protein B456_009G161300 [Gossypium raimondii] gi|763799887|gb|KJB66842.1| hypothetical protein B456_010G160100 [Gossypium raimondii] gi|763799888|gb|KJB66843.1| hypothetical protein B456_010G160100 [Gossypium raimondii] gi|763801414|gb|KJB68369.1| hypothetical protein B456_010G241400 [Gossypium raimondii] gi|763802761|gb|KJB69699.1| hypothetical protein B456_011G038200 [Gossypium raimondii] Length = 182 Score = 110 bits (275), Expect = 4e-22 Identities = 57/58 (98%), Positives = 58/58 (100%) Frame = +1 Query: 34 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRS 207 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRS Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRS 58 >gb|KJB57390.1| hypothetical protein B456_009G161300 [Gossypium raimondii] Length = 154 Score = 110 bits (275), Expect = 4e-22 Identities = 57/58 (98%), Positives = 58/58 (100%) Frame = +1 Query: 34 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRS 207 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRS Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRS 58 >ref|XP_011082984.1| PREDICTED: 60S ribosomal protein L11 [Sesamum indicum] Length = 183 Score = 110 bits (275), Expect = 4e-22 Identities = 57/58 (98%), Positives = 58/58 (100%) Frame = +1 Query: 34 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRS 207 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRS Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRS 58 >ref|XP_011081868.1| PREDICTED: 60S ribosomal protein L11-like [Sesamum indicum] Length = 183 Score = 110 bits (275), Expect = 4e-22 Identities = 57/58 (98%), Positives = 58/58 (100%) Frame = +1 Query: 34 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRS 207 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRS Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRS 58 >ref|XP_011088013.1| PREDICTED: 60S ribosomal protein L11-like [Sesamum indicum] Length = 183 Score = 110 bits (275), Expect = 4e-22 Identities = 57/58 (98%), Positives = 58/58 (100%) Frame = +1 Query: 34 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRS 207 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRS Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRS 58 >ref|XP_011039398.1| PREDICTED: 60S ribosomal protein L11 [Populus euphratica] gi|743891603|ref|XP_011039399.1| PREDICTED: 60S ribosomal protein L11 [Populus euphratica] gi|743891607|ref|XP_011039400.1| PREDICTED: 60S ribosomal protein L11 [Populus euphratica] Length = 182 Score = 110 bits (275), Expect = 4e-22 Identities = 57/58 (98%), Positives = 58/58 (100%) Frame = +1 Query: 34 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRS 207 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRS Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRS 58