BLASTX nr result
ID: Cinnamomum24_contig00035658
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00035658 (533 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KOS46810.1| hypothetical protein ACN38_g2277 [Penicillium nor... 120 5e-25 ref|XP_003850653.1| 40S ribosomal protein S28 [Zymoseptoria trit... 119 1e-24 ref|XP_008085508.1| Nucleic acid-binding protein [Glarea lozoyen... 117 3e-24 gb|EMR82428.1| putative 40s ribosomal protein s28 protein [Botry... 117 3e-24 ref|XP_007681584.1| hypothetical protein BAUCODRAFT_315059 [Baud... 117 3e-24 gb|EKG14828.1| Ribosomal protein S28e [Macrophomina phaseolina M... 117 4e-24 ref|XP_002153086.1| 40S ribosomal protein S28 [Talaromyces marne... 116 6e-24 gb|ESZ95319.1| 40S ribosomal protein S28 [Sclerotinia borealis F... 116 6e-24 ref|XP_012743726.1| 40S ribosomal protein S28 [Pseudogymnoascus ... 116 6e-24 gb|KDB13252.1| IBR domain-containing protein [Ustilaginoidea vir... 115 1e-23 ref|XP_003009124.1| 40S ribosomal protein S28 [Verticillium alfa... 115 1e-23 ref|XP_007779255.1| 40S ribosomal protein S28 [Coniosporium apol... 115 1e-23 ref|XP_007582595.1| putative 40s ribosomal protein s28 protein [... 115 1e-23 ref|XP_001561242.1| 40S ribosomal protein S28 [Botrytis cinerea ... 115 2e-23 gb|KJK62941.1| S1S28E like protein [Aspergillus parasiticus SU-1] 114 2e-23 ref|XP_007600844.1| 40S ribosomal protein S28 [Colletotrichum fi... 114 3e-23 ref|XP_007827699.1| 40S ribosomal protein S28 [Pestalotiopsis fi... 114 3e-23 ref|XP_003000163.1| 40S ribosomal protein S28 [Verticillium alfa... 114 4e-23 ref|XP_007915668.1| putative 40s ribosomal protein s28 protein [... 114 4e-23 gb|KKA26499.1| hypothetical protein TD95_004483 [Thielaviopsis p... 113 5e-23 >gb|KOS46810.1| hypothetical protein ACN38_g2277 [Penicillium nordicum] Length = 142 Score = 120 bits (300), Expect = 5e-25 Identities = 61/72 (84%), Positives = 64/72 (88%) Frame = -2 Query: 505 NQTSTRPAHTVKMDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGP 326 N + RP T KMDS+K PVKLVKVTRVLGRTGSRGGVTQVRVEFMDDT+RSIIRNVKGP Sbjct: 63 NPRAQRPLQTSKMDSSKQPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTSRSIIRNVKGP 122 Query: 325 VREDDILCLLES 290 VR DDILCLLES Sbjct: 123 VRVDDILCLLES 134 >ref|XP_003850653.1| 40S ribosomal protein S28 [Zymoseptoria tritici IPO323] gi|631388890|ref|XP_007928825.1| hypothetical protein MYCFIDRAFT_49708 [Pseudocercospora fijiensis CIRAD86] gi|339470532|gb|EGP85629.1| hypothetical protein MYCGRDRAFT_81501 [Zymoseptoria tritici IPO323] gi|452980191|gb|EME79952.1| hypothetical protein MYCFIDRAFT_49708 [Pseudocercospora fijiensis CIRAD86] gi|752275464|dbj|GAM89234.1| hypothetical protein ANO11243_072710 [fungal sp. No.11243] gi|796706002|gb|KJX97506.1| 40s ribosomal protein s28 [Zymoseptoria brevis] Length = 68 Score = 119 bits (297), Expect = 1e-24 Identities = 60/60 (100%), Positives = 60/60 (100%) Frame = -2 Query: 469 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILCLLES 290 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILCLLES Sbjct: 1 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILCLLES 60 >ref|XP_008085508.1| Nucleic acid-binding protein [Glarea lozoyensis ATCC 20868] gi|512199315|gb|EPE28149.1| Nucleic acid-binding protein [Glarea lozoyensis ATCC 20868] gi|751749436|gb|KIM97619.1| hypothetical protein OIDMADRAFT_20164 [Oidiodendron maius Zn] Length = 68 Score = 117 bits (294), Expect = 3e-24 Identities = 59/60 (98%), Positives = 60/60 (100%) Frame = -2 Query: 469 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILCLLES 290 MDS+KVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILCLLES Sbjct: 1 MDSSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILCLLES 60 >gb|EMR82428.1| putative 40s ribosomal protein s28 protein [Botrytis cinerea BcDW1] Length = 114 Score = 117 bits (293), Expect = 3e-24 Identities = 64/82 (78%), Positives = 68/82 (82%), Gaps = 6/82 (7%) Frame = -2 Query: 517 TLAPNQ------TSTRPAHTVKMDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTT 356 T AP+Q S R KM+++KVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTT Sbjct: 25 TPAPSQFINHIPKSKRINPIAKMEASKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTT 84 Query: 355 RSIIRNVKGPVREDDILCLLES 290 RSIIRNVKGPVREDDILCLLES Sbjct: 85 RSIIRNVKGPVREDDILCLLES 106 >ref|XP_007681584.1| hypothetical protein BAUCODRAFT_315059 [Baudoinia panamericana UAMH 10762] gi|918824268|ref|XP_013430056.1| ribosomal protein S28e [Aureobasidium namibiae CBS 147.97] gi|449295094|gb|EMC91116.1| hypothetical protein BAUCODRAFT_315059 [Baudoinia panamericana UAMH 10762] gi|662503260|gb|KEQ60881.1| ribosomal protein S28e [Aureobasidium melanogenum CBS 110374] gi|662518527|gb|KEQ76087.1| ribosomal protein S28e [Aureobasidium namibiae CBS 147.97] gi|662527623|gb|KEQ85002.1| ribosomal protein S28e [Aureobasidium pullulans EXF-150] Length = 68 Score = 117 bits (293), Expect = 3e-24 Identities = 59/60 (98%), Positives = 60/60 (100%) Frame = -2 Query: 469 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILCLLES 290 M+SAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILCLLES Sbjct: 1 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILCLLES 60 >gb|EKG14828.1| Ribosomal protein S28e [Macrophomina phaseolina MS6] gi|407924574|gb|EKG17607.1| Histone core [Macrophomina phaseolina MS6] gi|821064263|gb|KKY19538.1| putative 40s ribosomal protein s28 [Diplodia seriata] gi|821064801|gb|KKY20058.1| putative 40s ribosomal protein s28 [Diplodia seriata] Length = 68 Score = 117 bits (292), Expect = 4e-24 Identities = 59/60 (98%), Positives = 60/60 (100%) Frame = -2 Query: 469 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILCLLES 290 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRE+DILCLLES Sbjct: 1 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDILCLLES 60 >ref|XP_002153086.1| 40S ribosomal protein S28 [Talaromyces marneffei ATCC 18224] gi|242820646|ref|XP_002487548.1| 40S ribosomal protein S28 [Talaromyces stipitatus ATCC 10500] gi|242820650|ref|XP_002487549.1| 40S ribosomal protein S28 [Talaromyces stipitatus ATCC 10500] gi|210064606|gb|EEA18701.1| Ribosomal protein S28e [Talaromyces marneffei ATCC 18224] gi|218714013|gb|EED13437.1| Ribosomal protein S28e [Talaromyces stipitatus ATCC 10500] gi|218714014|gb|EED13438.1| Ribosomal protein S28e [Talaromyces stipitatus ATCC 10500] gi|680000722|gb|KFX52824.1| 40S ribosomal protein S28 [Talaromyces marneffei PM1] gi|748550736|dbj|GAM43411.1| ribosomal protein [Talaromyces cellulolyticus] gi|816186318|emb|CRG91631.1| hypothetical protein PISL3812_08681 [Talaromyces islandicus] Length = 68 Score = 116 bits (291), Expect = 6e-24 Identities = 59/60 (98%), Positives = 59/60 (98%) Frame = -2 Query: 469 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILCLLES 290 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVREDDILCLLES Sbjct: 1 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILCLLES 60 >gb|ESZ95319.1| 40S ribosomal protein S28 [Sclerotinia borealis F-4157] Length = 68 Score = 116 bits (291), Expect = 6e-24 Identities = 58/60 (96%), Positives = 60/60 (100%) Frame = -2 Query: 469 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILCLLES 290 MD++KVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILCLLES Sbjct: 1 MDASKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILCLLES 60 >ref|XP_012743726.1| 40S ribosomal protein S28 [Pseudogymnoascus destructans 20631-21] gi|440632220|gb|ELR02139.1| 40S ribosomal protein S28 [Pseudogymnoascus destructans 20631-21] Length = 68 Score = 116 bits (291), Expect = 6e-24 Identities = 58/60 (96%), Positives = 60/60 (100%) Frame = -2 Query: 469 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILCLLES 290 MD++KVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILCLLES Sbjct: 1 MDTSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILCLLES 60 >gb|KDB13252.1| IBR domain-containing protein [Ustilaginoidea virens] Length = 480 Score = 115 bits (288), Expect = 1e-23 Identities = 58/64 (90%), Positives = 59/64 (92%) Frame = -2 Query: 481 HTVKMDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 302 H MDS+K PVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVREDDILC Sbjct: 409 HDTIMDSSKAPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 468 Query: 301 LLES 290 LLES Sbjct: 469 LLES 472 >ref|XP_003009124.1| 40S ribosomal protein S28 [Verticillium alfalfae VaMs.102] gi|697069809|ref|XP_009650088.1| hypothetical protein VDAG_00416 [Verticillium dahliae VdLs.17] gi|261352270|gb|EEY14698.1| 40S ribosomal protein S28 [Verticillium alfalfae VaMs.102] gi|346970282|gb|EGY13734.1| hypothetical protein VDAG_00416 [Verticillium dahliae VdLs.17] gi|913765558|emb|CRK36463.1| hypothetical protein BN1708_007062 [Verticillium longisporum] gi|913796818|emb|CRK15241.1| hypothetical protein BN1708_011409 [Verticillium longisporum] gi|913900802|emb|CRK11466.1| hypothetical protein BN1723_001798 [Verticillium longisporum] Length = 68 Score = 115 bits (288), Expect = 1e-23 Identities = 58/60 (96%), Positives = 59/60 (98%) Frame = -2 Query: 469 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILCLLES 290 MDS+KVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVREDDILCLLES Sbjct: 1 MDSSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILCLLES 60 >ref|XP_007779255.1| 40S ribosomal protein S28 [Coniosporium apollinis CBS 100218] gi|494826922|gb|EON63938.1| 40S ribosomal protein S28 [Coniosporium apollinis CBS 100218] Length = 68 Score = 115 bits (288), Expect = 1e-23 Identities = 58/60 (96%), Positives = 60/60 (100%) Frame = -2 Query: 469 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILCLLES 290 MDSAKVPVKLVKVTRVLGRTGSRGGV+QVRVEFMDDTTRSIIRNVKGPVRE+DILCLLES Sbjct: 1 MDSAKVPVKLVKVTRVLGRTGSRGGVSQVRVEFMDDTTRSIIRNVKGPVRENDILCLLES 60 >ref|XP_007582595.1| putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] gi|615415585|ref|XP_007584949.1| putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] gi|485922014|gb|EOD47615.1| putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] gi|485925270|gb|EOD49893.1| putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] Length = 68 Score = 115 bits (288), Expect = 1e-23 Identities = 58/60 (96%), Positives = 60/60 (100%) Frame = -2 Query: 469 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILCLLES 290 M+SAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRE+DILCLLES Sbjct: 1 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDILCLLES 60 >ref|XP_001561242.1| 40S ribosomal protein S28 [Botrytis cinerea B05.10] gi|347829972|emb|CCD45669.1| hypothetical protein BofuT4P34000010001 [Botrytis cinerea T4] Length = 68 Score = 115 bits (287), Expect = 2e-23 Identities = 57/60 (95%), Positives = 60/60 (100%) Frame = -2 Query: 469 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILCLLES 290 M+++KVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILCLLES Sbjct: 1 MEASKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILCLLES 60 >gb|KJK62941.1| S1S28E like protein [Aspergillus parasiticus SU-1] Length = 1036 Score = 114 bits (286), Expect = 2e-23 Identities = 61/81 (75%), Positives = 65/81 (80%), Gaps = 3/81 (3%) Frame = -2 Query: 523 PDTLAPNQTSTRPAH---TVKMDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTR 353 P T AP ++P + MDSAK PVKLVKVTRVLGRTGSRGGVTQVRVEFMDD +R Sbjct: 948 PSTHAPRLDQSQPQRENQSFAMDSAKAPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQSR 1007 Query: 352 SIIRNVKGPVREDDILCLLES 290 SIIRNVKGPVR DDILCLLES Sbjct: 1008 SIIRNVKGPVRVDDILCLLES 1028 >ref|XP_007600844.1| 40S ribosomal protein S28 [Colletotrichum fioriniae PJ7] gi|588893325|gb|EXF75473.1| 40S ribosomal protein S28 [Colletotrichum fioriniae PJ7] Length = 68 Score = 114 bits (285), Expect = 3e-23 Identities = 58/60 (96%), Positives = 58/60 (96%) Frame = -2 Query: 469 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILCLLES 290 MDSAK PVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVREDDILCLLES Sbjct: 1 MDSAKQPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDETRSIIRNVKGPVREDDILCLLES 60 >ref|XP_007827699.1| 40S ribosomal protein S28 [Pestalotiopsis fici W106-1] gi|827075690|ref|XP_008099256.1| ribosomal protein S28e [Colletotrichum graminicola M1.001] gi|310800343|gb|EFQ35236.1| ribosomal protein S28e [Colletotrichum graminicola M1.001] gi|380474013|emb|CCF46007.1| 40S ribosomal protein S28 [Colletotrichum higginsianum] gi|573067571|gb|ETS87099.1| 40S ribosomal protein S28 [Pestalotiopsis fici W106-1] gi|640921526|gb|KDN65874.1| putative 40S ribosomal protein S28 [Colletotrichum sublineola] Length = 68 Score = 114 bits (285), Expect = 3e-23 Identities = 58/60 (96%), Positives = 58/60 (96%) Frame = -2 Query: 469 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILCLLES 290 MDSAK PVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVREDDILCLLES Sbjct: 1 MDSAKQPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILCLLES 60 >ref|XP_003000163.1| 40S ribosomal protein S28 [Verticillium alfalfae VaMs.102] gi|697076619|ref|XP_009652495.1| 40S ribosomal protein S28 [Verticillium dahliae VdLs.17] gi|261360820|gb|EEY23248.1| 40S ribosomal protein S28 [Verticillium alfalfae VaMs.102] gi|346979706|gb|EGY23158.1| 40S ribosomal protein S28 [Verticillium dahliae VdLs.17] gi|729185410|emb|CEJ91264.1| Putative 40S ribosomal protein S28 [Torrubiella hemipterigena] gi|913767874|emb|CRK34680.1| hypothetical protein BN1708_016348 [Verticillium longisporum] Length = 68 Score = 114 bits (284), Expect = 4e-23 Identities = 57/60 (95%), Positives = 58/60 (96%) Frame = -2 Query: 469 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILCLLES 290 MDS+K PVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVREDDILCLLES Sbjct: 1 MDSSKTPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILCLLES 60 >ref|XP_007915668.1| putative 40s ribosomal protein s28 protein [Togninia minima UCRPA7] gi|953394942|ref|XP_014541713.1| Ribosomal protein S28e, partial [Metarhizium brunneum ARSEF 3297] gi|399165856|emb|CCE33319.1| probable ribosomal protein S28B [Claviceps purpurea 20.1] gi|500256292|gb|EON99563.1| putative 40s ribosomal protein s28 protein [Phaeoacremonium minimum UCRPA7] gi|594720915|gb|EXV03803.1| ribosomal protein S28e [Metarhizium robertsii] gi|672383491|gb|KFG85603.1| 40S ribosomal protein S28 [Metarhizium anisopliae] gi|743638615|gb|KID69986.1| Ribosomal protein S28e, partial [Metarhizium anisopliae ARSEF 549] gi|743641156|gb|KID72508.1| Ribosomal protein S28e, partial [Metarhizium brunneum ARSEF 3297] gi|743662232|gb|KID89430.1| Ribosomal protein S28e [Metarhizium guizhouense ARSEF 977] gi|770389641|gb|KJK75639.1| hypothetical protein H634G_09003 [Metarhizium anisopliae BRIP 53293] gi|770409186|gb|KJK93999.1| hypothetical protein H633G_02099 [Metarhizium anisopliae BRIP 53284] gi|799246995|gb|KJZ75767.1| 40S ribosomal protein S28 [Hirsutella minnesotensis 3608] Length = 68 Score = 114 bits (284), Expect = 4e-23 Identities = 57/60 (95%), Positives = 58/60 (96%) Frame = -2 Query: 469 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILCLLES 290 MDS+K PVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVREDDILCLLES Sbjct: 1 MDSSKAPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILCLLES 60 >gb|KKA26499.1| hypothetical protein TD95_004483 [Thielaviopsis punctulata] Length = 68 Score = 113 bits (283), Expect = 5e-23 Identities = 57/60 (95%), Positives = 59/60 (98%) Frame = -2 Query: 469 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILCLLES 290 M+SAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVRE+DILCLLES Sbjct: 1 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDNTRSIIRNVKGPVRENDILCLLES 60