BLASTX nr result
ID: Cinnamomum24_contig00035648
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00035648 (239 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJX94094.1| hypothetical protein TI39_contig4219g00015 [Zymos... 57 5e-06 gb|EMF14218.1| GroES-like protein, partial [Sphaerulina musiva S... 57 5e-06 gb|EME46799.1| hypothetical protein DOTSEDRAFT_125439, partial [... 57 5e-06 ref|XP_003857779.1| hypothetical protein MYCGRDRAFT_34808, parti... 57 7e-06 >gb|KJX94094.1| hypothetical protein TI39_contig4219g00015 [Zymoseptoria brevis] Length = 1501 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/49 (57%), Positives = 35/49 (71%), Gaps = 2/49 (4%) Frame = -1 Query: 152 ATMPSAYSTSPFLSLRPDSECGRTVT--PSAPRKSFASLSGAATPATNG 12 A MPS S SPF+SLRPD ECGR+ + P+ P +SF +LSG A+P NG Sbjct: 39 AKMPSHLSNSPFISLRPDHECGRSKSQAPTPPTRSFGTLSGTASPYGNG 87 >gb|EMF14218.1| GroES-like protein, partial [Sphaerulina musiva SO2202] Length = 422 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = -1 Query: 146 MPSAYSTSPFLSLRPDSECGRTVTPSAPRKSFASLSGAATP 24 MPS YS++PFLSL+P+S+CGR T P KSF+SLSGAATP Sbjct: 1 MPSTYSSAPFLSLKPNSDCGRGQT--QPGKSFSSLSGAATP 39 >gb|EME46799.1| hypothetical protein DOTSEDRAFT_125439, partial [Dothistroma septosporum NZE10] Length = 446 Score = 57.0 bits (136), Expect = 5e-06 Identities = 29/45 (64%), Positives = 32/45 (71%) Frame = -1 Query: 146 MPSAYSTSPFLSLRPDSECGRTVTPSAPRKSFASLSGAATPATNG 12 MPS YS SPF+SL+ D CGR S+ KSFASLSG ATPA NG Sbjct: 1 MPSTYSNSPFVSLKADQNCGR-ANGSSTSKSFASLSGNATPAVNG 44 >ref|XP_003857779.1| hypothetical protein MYCGRDRAFT_34808, partial [Zymoseptoria tritici IPO323] gi|339477664|gb|EGP92755.1| hypothetical protein MYCGRDRAFT_34808, partial [Zymoseptoria tritici IPO323] Length = 456 Score = 56.6 bits (135), Expect = 7e-06 Identities = 28/47 (59%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = -1 Query: 146 MPSAYSTSPFLSLRPDSECGRTVT--PSAPRKSFASLSGAATPATNG 12 MPS S SPF+SLRPD ECGR+ + P+ P +SF +LSGAA+P NG Sbjct: 1 MPSHLSNSPFISLRPDHECGRSKSQAPTPPTRSFDTLSGAASPNGNG 47