BLASTX nr result
ID: Cinnamomum24_contig00035485
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00035485 (431 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME48629.1| hypothetical protein DOTSEDRAFT_67613 [Dothistrom... 76 9e-12 >gb|EME48629.1| hypothetical protein DOTSEDRAFT_67613 [Dothistroma septosporum NZE10] Length = 56 Score = 76.3 bits (186), Expect = 9e-12 Identities = 40/59 (67%), Positives = 47/59 (79%), Gaps = 1/59 (1%) Frame = -2 Query: 286 MQFFKSASAWALFSVCMLLGNVIAAP-LAARSEDLNYDVLPGKQLNADQVDDTDAGDAY 113 MQFFKS+ +F+VC+LLG+ IAAP L RSEDLNYDVLPGKQ N + V DTD+GDAY Sbjct: 1 MQFFKSS---IVFAVCLLLGSTIAAPALQRRSEDLNYDVLPGKQRNPEMVRDTDSGDAY 56