BLASTX nr result
ID: Cinnamomum24_contig00035414
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00035414 (296 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME49807.1| hypothetical protein DOTSEDRAFT_68559 [Dothistrom... 57 4e-06 >gb|EME49807.1| hypothetical protein DOTSEDRAFT_68559 [Dothistroma septosporum NZE10] Length = 659 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/52 (53%), Positives = 36/52 (69%), Gaps = 1/52 (1%) Frame = -1 Query: 281 DPAEENVRYQRQIRPEDIRVQSGYNYKRS-NSDRPGVSRTGSGNPIYTSARA 129 D A E++R+ + RPED++V+SG R NSDRP +SR GSGNPIY RA Sbjct: 608 DSARESIRHAPRTRPEDLKVRSGAGSTRQYNSDRPTMSRNGSGNPIYAGVRA 659