BLASTX nr result
ID: Cinnamomum24_contig00035375
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00035375 (229 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009380133.1| PREDICTED: meiotic recombination protein SPO... 61 4e-07 >ref|XP_009380133.1| PREDICTED: meiotic recombination protein SPO11-1 [Musa acuminata subsp. malaccensis] Length = 361 Score = 60.8 bits (146), Expect = 4e-07 Identities = 36/66 (54%), Positives = 42/66 (63%) Frame = -1 Query: 199 RDSSPKPQNLHLLQRIKGFTRSLLEDLCIRHCLPSITLDRYRNYCSDPTGXXXXXXXXXN 20 R SS P +L LQRIKGF RSL+EDL PS+ LDRYRNYC DP+G N Sbjct: 5 RVSSSSPSDL--LQRIKGFVRSLVEDLS-NDRPPSVALDRYRNYCHDPSGNCTCGDNLPN 61 Query: 19 GEEILS 2 G+EI+S Sbjct: 62 GKEIIS 67