BLASTX nr result
ID: Cinnamomum24_contig00034984
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00034984 (436 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010530398.1| PREDICTED: probable LRR receptor-like serine... 56 9e-06 ref|XP_010537627.1| PREDICTED: probable LRR receptor-like serine... 56 9e-06 ref|XP_002300567.2| leucine-rich repeat family protein [Populus ... 56 9e-06 ref|XP_006377954.1| leucine-rich repeat family protein [Populus ... 56 9e-06 ref|XP_007022925.1| Leucine-rich receptor-like protein kinase fa... 56 9e-06 >ref|XP_010530398.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g20940 [Tarenaya hassleriana] Length = 1059 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 100 FVMSAIAQLPSQDILALLEFKKGIKLDPTGYI 5 F +SA+ QLPSQDILALLEFKKGIK DPTGY+ Sbjct: 12 FFLSAMGQLPSQDILALLEFKKGIKHDPTGYV 43 >ref|XP_010537627.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g20940 [Tarenaya hassleriana] gi|729294758|ref|XP_010537634.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g20940 [Tarenaya hassleriana] Length = 1059 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 100 FVMSAIAQLPSQDILALLEFKKGIKLDPTGYI 5 F +SA+ QLPSQDILALLEFKKGIK DPTGY+ Sbjct: 12 FFLSAMGQLPSQDILALLEFKKGIKHDPTGYV 43 >ref|XP_002300567.2| leucine-rich repeat family protein [Populus trichocarpa] gi|550350055|gb|EEE85372.2| leucine-rich repeat family protein [Populus trichocarpa] Length = 1008 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 100 FVMSAIAQLPSQDILALLEFKKGIKLDPTGYI 5 F +SA+ QLPSQDILALLEFKKGIK DPTGY+ Sbjct: 12 FFLSAMGQLPSQDILALLEFKKGIKHDPTGYV 43 >ref|XP_006377954.1| leucine-rich repeat family protein [Populus trichocarpa] gi|550328559|gb|ERP55751.1| leucine-rich repeat family protein [Populus trichocarpa] Length = 1072 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 100 FVMSAIAQLPSQDILALLEFKKGIKLDPTGYI 5 F +SA+ QLPSQDILALLEFKKGIK DPTGY+ Sbjct: 12 FFLSAMGQLPSQDILALLEFKKGIKHDPTGYV 43 >ref|XP_007022925.1| Leucine-rich receptor-like protein kinase family protein [Theobroma cacao] gi|508778291|gb|EOY25547.1| Leucine-rich receptor-like protein kinase family protein [Theobroma cacao] Length = 1058 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 100 FVMSAIAQLPSQDILALLEFKKGIKLDPTGYI 5 F +SA+ QLPSQDILALLEFKKGIK DPTGY+ Sbjct: 12 FFLSAMGQLPSQDILALLEFKKGIKHDPTGYV 43