BLASTX nr result
ID: Cinnamomum24_contig00034938
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00034938 (223 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010908886.1| PREDICTED: caffeoylshikimate esterase-like i... 57 7e-06 ref|XP_010908885.1| PREDICTED: caffeoylshikimate esterase-like i... 57 7e-06 >ref|XP_010908886.1| PREDICTED: caffeoylshikimate esterase-like isoform X2 [Elaeis guineensis] Length = 291 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -3 Query: 98 MAQYMDNIRYEEKFITNKRGLVLFTCRWLPEN 3 MAQ +NIRYEE+FITN GL LFTCRWLPEN Sbjct: 1 MAQNNENIRYEEEFITNPHGLKLFTCRWLPEN 32 >ref|XP_010908885.1| PREDICTED: caffeoylshikimate esterase-like isoform X1 [Elaeis guineensis] Length = 302 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -3 Query: 98 MAQYMDNIRYEEKFITNKRGLVLFTCRWLPEN 3 MAQ +NIRYEE+FITN GL LFTCRWLPEN Sbjct: 1 MAQNNENIRYEEEFITNPHGLKLFTCRWLPEN 32