BLASTX nr result
ID: Cinnamomum24_contig00034889
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00034889 (243 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009391177.1| PREDICTED: high mobility group B protein 9-l... 67 4e-09 ref|XP_009406430.1| PREDICTED: high mobility group B protein 9-l... 62 1e-07 ref|XP_011629069.1| PREDICTED: high mobility group B protein 9 [... 57 7e-06 gb|ERM96293.1| hypothetical protein AMTR_s00001p00177580 [Ambore... 57 7e-06 >ref|XP_009391177.1| PREDICTED: high mobility group B protein 9-like [Musa acuminata subsp. malaccensis] Length = 352 Score = 67.4 bits (163), Expect = 4e-09 Identities = 33/45 (73%), Positives = 36/45 (80%) Frame = -1 Query: 243 LTQEEKMKYNACGLKDKERYKREMQEYKERMKLVQHKEAARASPS 109 L +EE+M Y GLKDKERYKREMQEYKER+KLVQ KE A A PS Sbjct: 293 LNEEERMVYQNYGLKDKERYKREMQEYKERLKLVQPKEMAGAEPS 337 >ref|XP_009406430.1| PREDICTED: high mobility group B protein 9-like [Musa acuminata subsp. malaccensis] Length = 350 Score = 62.4 bits (150), Expect = 1e-07 Identities = 32/48 (66%), Positives = 37/48 (77%), Gaps = 2/48 (4%) Frame = -1 Query: 243 LTQEEKMKYNACGLKDKERYKREMQEYKERMKLVQHKE--AARASPSS 106 L++EE++ Y GLKDKERYK EMQEYKER+KL Q KE ARA PSS Sbjct: 289 LSEEERLVYQDYGLKDKERYKMEMQEYKERLKLAQPKEVTVARAEPSS 336 >ref|XP_011629069.1| PREDICTED: high mobility group B protein 9 [Amborella trichopoda] Length = 328 Score = 56.6 bits (135), Expect = 7e-06 Identities = 23/35 (65%), Positives = 32/35 (91%) Frame = -1 Query: 243 LTQEEKMKYNACGLKDKERYKREMQEYKERMKLVQ 139 LT+EE++ Y CGL+DKERY+REMQEY+ER+KL++ Sbjct: 252 LTEEERLVYQDCGLQDKERYRREMQEYRERLKLLR 286 >gb|ERM96293.1| hypothetical protein AMTR_s00001p00177580 [Amborella trichopoda] Length = 367 Score = 56.6 bits (135), Expect = 7e-06 Identities = 23/35 (65%), Positives = 32/35 (91%) Frame = -1 Query: 243 LTQEEKMKYNACGLKDKERYKREMQEYKERMKLVQ 139 LT+EE++ Y CGL+DKERY+REMQEY+ER+KL++ Sbjct: 291 LTEEERLVYQDCGLQDKERYRREMQEYRERLKLLR 325