BLASTX nr result
ID: Cinnamomum24_contig00034361
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00034361 (283 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010911198.1| PREDICTED: F-box protein At5g39450 [Elaeis g... 57 5e-06 >ref|XP_010911198.1| PREDICTED: F-box protein At5g39450 [Elaeis guineensis] Length = 631 Score = 57.0 bits (136), Expect = 5e-06 Identities = 29/58 (50%), Positives = 40/58 (68%) Frame = -2 Query: 267 LVANQVRLKVPSSLSCSPLFPHQSSIDTEDIDLGLFAGRRAHLLQIHKLSGGAADRQL 94 LVA +VRLKVP L+ +PLFP S+ D D+ + A RR L+Q+HKL+GG DR++ Sbjct: 268 LVAGKVRLKVPQDLAAAPLFPCSSTHD----DIAILADRRLSLIQMHKLNGGRMDRKV 321