BLASTX nr result
ID: Cinnamomum24_contig00034343
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00034343 (335 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011623778.1| PREDICTED: trimethylguanosine synthase [Ambo... 57 4e-06 gb|ERN07089.1| hypothetical protein AMTR_s00019p00080670 [Ambore... 57 4e-06 ref|XP_008228857.1| PREDICTED: trimethylguanosine synthase [Prun... 56 9e-06 ref|XP_007215855.1| hypothetical protein PRUPE_ppa010390mg [Prun... 56 9e-06 >ref|XP_011623778.1| PREDICTED: trimethylguanosine synthase [Amborella trichopoda] Length = 255 Score = 57.4 bits (137), Expect = 4e-06 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = +2 Query: 227 ISEGISPLVSKYWHQRYNLFSRYDEGIKMD 316 + EG+SP ++KYW+QRYNLFSRYDEGI+MD Sbjct: 44 VPEGVSPCITKYWYQRYNLFSRYDEGIEMD 73 >gb|ERN07089.1| hypothetical protein AMTR_s00019p00080670 [Amborella trichopoda] Length = 317 Score = 57.4 bits (137), Expect = 4e-06 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = +2 Query: 227 ISEGISPLVSKYWHQRYNLFSRYDEGIKMD 316 + EG+SP ++KYW+QRYNLFSRYDEGI+MD Sbjct: 44 VPEGVSPCITKYWYQRYNLFSRYDEGIEMD 73 >ref|XP_008228857.1| PREDICTED: trimethylguanosine synthase [Prunus mume] Length = 251 Score = 56.2 bits (134), Expect = 9e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +2 Query: 227 ISEGISPLVSKYWHQRYNLFSRYDEGIKMD 316 + EG++PLV KYW QRY+LFSRYDEGIKMD Sbjct: 34 LEEGLTPLVEKYWFQRYDLFSRYDEGIKMD 63 >ref|XP_007215855.1| hypothetical protein PRUPE_ppa010390mg [Prunus persica] gi|462412005|gb|EMJ17054.1| hypothetical protein PRUPE_ppa010390mg [Prunus persica] Length = 251 Score = 56.2 bits (134), Expect = 9e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +2 Query: 227 ISEGISPLVSKYWHQRYNLFSRYDEGIKMD 316 + EG++PLV KYW QRY+LFSRYDEGIKMD Sbjct: 34 LEEGLTPLVEKYWFQRYDLFSRYDEGIKMD 63