BLASTX nr result
ID: Cinnamomum24_contig00033647
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00033647 (287 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010267060.1| PREDICTED: pentatricopeptide repeat-containi... 94 4e-17 ref|XP_010647552.1| PREDICTED: pentatricopeptide repeat-containi... 81 3e-13 ref|XP_010647551.1| PREDICTED: pentatricopeptide repeat-containi... 81 3e-13 ref|XP_010647550.1| PREDICTED: pentatricopeptide repeat-containi... 81 3e-13 ref|XP_010652685.1| PREDICTED: pentatricopeptide repeat-containi... 81 3e-13 ref|XP_003632478.1| PREDICTED: pentatricopeptide repeat-containi... 81 3e-13 emb|CAN70653.1| hypothetical protein VITISV_010023 [Vitis vinifera] 81 3e-13 emb|CBI33142.3| unnamed protein product [Vitis vinifera] 81 3e-13 ref|XP_004504105.1| PREDICTED: pentatricopeptide repeat-containi... 79 1e-12 ref|XP_009391323.1| PREDICTED: pentatricopeptide repeat-containi... 79 2e-12 ref|XP_006828004.2| PREDICTED: pentatricopeptide repeat-containi... 78 2e-12 gb|ERM95420.1| hypothetical protein AMTR_s00008p00241920 [Ambore... 78 2e-12 ref|XP_010939694.1| PREDICTED: pentatricopeptide repeat-containi... 77 5e-12 gb|KRH43148.1| hypothetical protein GLYMA_08G133500 [Glycine max] 77 7e-12 gb|KHN29038.1| Pentatricopeptide repeat-containing protein [Glyc... 76 9e-12 ref|XP_012469820.1| PREDICTED: pentatricopeptide repeat-containi... 76 1e-11 ref|XP_006660222.1| PREDICTED: pentatricopeptide repeat-containi... 76 1e-11 ref|XP_006353205.1| PREDICTED: pentatricopeptide repeat-containi... 76 1e-11 ref|XP_007047867.1| Tetratricopeptide repeat-like superfamily pr... 76 1e-11 gb|KJB18235.1| hypothetical protein B456_003G041200 [Gossypium r... 75 1e-11 >ref|XP_010267060.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Nelumbo nucifera] Length = 592 Score = 94.0 bits (232), Expect = 4e-17 Identities = 43/66 (65%), Positives = 54/66 (81%), Gaps = 1/66 (1%) Frame = -2 Query: 286 EVTRVRGLMKEQGVKKQPGYSWMEIGGQVHLFSGGGL-HPEIDRIHLELEKINLHMKINS 110 +VTRVR LMKEQGVKKQPGYSW EI +VHLF GG + HPEID+IHLEL++I L M++ Sbjct: 526 DVTRVRSLMKEQGVKKQPGYSWTEIANKVHLFLGGDISHPEIDKIHLELKRIGLQMRMMD 585 Query: 109 DIEDLI 92 D +D++ Sbjct: 586 DFQDIV 591 >ref|XP_010647552.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like isoform X3 [Vitis vinifera] Length = 181 Score = 81.3 bits (199), Expect = 3e-13 Identities = 41/65 (63%), Positives = 48/65 (73%), Gaps = 1/65 (1%) Frame = -2 Query: 286 EVTRVRGLMKEQGVKKQPGYSWMEIGGQVHLFSG-GGLHPEIDRIHLELEKINLHMKINS 110 EVTRVRGLM+EQGVKKQP YSWMEI +VH F G HPEI RI LEL+ + L M + Sbjct: 111 EVTRVRGLMREQGVKKQPAYSWMEIDNKVHFFLGDDASHPEIHRIRLELKGMKLQMIADD 170 Query: 109 DIEDL 95 DIE++ Sbjct: 171 DIEEV 175 >ref|XP_010647551.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like isoform X2 [Vitis vinifera] Length = 184 Score = 81.3 bits (199), Expect = 3e-13 Identities = 41/65 (63%), Positives = 48/65 (73%), Gaps = 1/65 (1%) Frame = -2 Query: 286 EVTRVRGLMKEQGVKKQPGYSWMEIGGQVHLFSG-GGLHPEIDRIHLELEKINLHMKINS 110 EVTRVRGLM+EQGVKKQP YSWMEI +VH F G HPEI RI LEL+ + L M + Sbjct: 114 EVTRVRGLMREQGVKKQPAYSWMEIDNKVHFFLGDDASHPEIHRIRLELKGMKLQMIADD 173 Query: 109 DIEDL 95 DIE++ Sbjct: 174 DIEEV 178 >ref|XP_010647550.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like isoform X1 [Vitis vinifera] Length = 207 Score = 81.3 bits (199), Expect = 3e-13 Identities = 41/65 (63%), Positives = 48/65 (73%), Gaps = 1/65 (1%) Frame = -2 Query: 286 EVTRVRGLMKEQGVKKQPGYSWMEIGGQVHLFSG-GGLHPEIDRIHLELEKINLHMKINS 110 EVTRVRGLM+EQGVKKQP YSWMEI +VH F G HPEI RI LEL+ + L M + Sbjct: 137 EVTRVRGLMREQGVKKQPAYSWMEIDNKVHFFLGDDASHPEIHRIRLELKGMKLQMIADD 196 Query: 109 DIEDL 95 DIE++ Sbjct: 197 DIEEV 201 >ref|XP_010652685.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like isoform X2 [Vitis vinifera] Length = 470 Score = 81.3 bits (199), Expect = 3e-13 Identities = 41/65 (63%), Positives = 48/65 (73%), Gaps = 1/65 (1%) Frame = -2 Query: 286 EVTRVRGLMKEQGVKKQPGYSWMEIGGQVHLFSG-GGLHPEIDRIHLELEKINLHMKINS 110 EVTRVRGLM+EQGVKKQP YSWMEI +VH F G HPEI RI LEL+ + L M + Sbjct: 400 EVTRVRGLMREQGVKKQPAYSWMEIDNKVHFFLGDDASHPEIHRIRLELKGMKLQMIADD 459 Query: 109 DIEDL 95 DIE++ Sbjct: 460 DIEEV 464 >ref|XP_003632478.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like isoform X1 [Vitis vinifera] Length = 590 Score = 81.3 bits (199), Expect = 3e-13 Identities = 41/65 (63%), Positives = 48/65 (73%), Gaps = 1/65 (1%) Frame = -2 Query: 286 EVTRVRGLMKEQGVKKQPGYSWMEIGGQVHLFSG-GGLHPEIDRIHLELEKINLHMKINS 110 EVTRVRGLM+EQGVKKQP YSWMEI +VH F G HPEI RI LEL+ + L M + Sbjct: 520 EVTRVRGLMREQGVKKQPAYSWMEIDNKVHFFLGDDASHPEIHRIRLELKGMKLQMIADD 579 Query: 109 DIEDL 95 DIE++ Sbjct: 580 DIEEV 584 >emb|CAN70653.1| hypothetical protein VITISV_010023 [Vitis vinifera] Length = 1301 Score = 81.3 bits (199), Expect = 3e-13 Identities = 41/65 (63%), Positives = 48/65 (73%), Gaps = 1/65 (1%) Frame = -2 Query: 286 EVTRVRGLMKEQGVKKQPGYSWMEIGGQVHLFSG-GGLHPEIDRIHLELEKINLHMKINS 110 EVTRVRGLM+EQGVKKQP YSWMEI +VH F G HPEI RI LEL+ + L M + Sbjct: 520 EVTRVRGLMREQGVKKQPAYSWMEIDNKVHFFLGDDASHPEIHRIRLELKGMKLQMIADD 579 Query: 109 DIEDL 95 DIE++ Sbjct: 580 DIEEV 584 >emb|CBI33142.3| unnamed protein product [Vitis vinifera] Length = 1198 Score = 80.9 bits (198), Expect = 3e-13 Identities = 41/64 (64%), Positives = 47/64 (73%), Gaps = 1/64 (1%) Frame = -2 Query: 286 EVTRVRGLMKEQGVKKQPGYSWMEIGGQVHLFSG-GGLHPEIDRIHLELEKINLHMKINS 110 EVTRVRGLM+EQGVKKQP YSWMEI +VH F G HPEI RI LEL+ + L M + Sbjct: 448 EVTRVRGLMREQGVKKQPAYSWMEIDNKVHFFLGDDASHPEIHRIRLELKGMKLQMIADD 507 Query: 109 DIED 98 DIE+ Sbjct: 508 DIEE 511 >ref|XP_004504105.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Cicer arietinum] Length = 569 Score = 79.0 bits (193), Expect = 1e-12 Identities = 37/66 (56%), Positives = 47/66 (71%), Gaps = 1/66 (1%) Frame = -2 Query: 286 EVTRVRGLMKEQGVKKQPGYSWMEIGGQVHLFSGGG-LHPEIDRIHLELEKINLHMKINS 110 +V RVR LMKEQGVKKQ YSWM+IG ++H F GG HP ID IH+ L +I LHMK+ Sbjct: 503 DVNRVRVLMKEQGVKKQRAYSWMQIGNKLHCFVGGDPSHPNIDDIHVALRRITLHMKVKG 562 Query: 109 DIEDLI 92 + E+ + Sbjct: 563 NFEEAV 568 >ref|XP_009391323.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Musa acuminata subsp. malaccensis] Length = 545 Score = 78.6 bits (192), Expect = 2e-12 Identities = 38/65 (58%), Positives = 48/65 (73%), Gaps = 1/65 (1%) Frame = -2 Query: 286 EVTRVRGLMKEQGVKKQPGYSWMEIGGQVHLFS-GGGLHPEIDRIHLELEKINLHMKINS 110 EV +VRGLMK+ G KKQPGYSW++I +VHLFS G HP+ID+I ELE+I HMK+ S Sbjct: 479 EVVKVRGLMKQNGAKKQPGYSWIQIADKVHLFSVGDASHPDIDKILSELERIGFHMKMFS 538 Query: 109 DIEDL 95 +L Sbjct: 539 HYANL 543 >ref|XP_006828004.2| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 [Amborella trichopoda] Length = 526 Score = 78.2 bits (191), Expect = 2e-12 Identities = 36/58 (62%), Positives = 48/58 (82%), Gaps = 1/58 (1%) Frame = -2 Query: 286 EVTRVRGLMKEQGVKKQPGYSWMEIGGQVHLF-SGGGLHPEIDRIHLELEKINLHMKI 116 EVTR+R LM+E+G+KKQPGYSWME G +VH+F G HP+I +IH EL++I+LHMK+ Sbjct: 449 EVTRLRFLMRERGLKKQPGYSWMETGSEVHMFLVGDTSHPDIAKIHEELQRIDLHMKM 506 >gb|ERM95420.1| hypothetical protein AMTR_s00008p00241920 [Amborella trichopoda] Length = 620 Score = 78.2 bits (191), Expect = 2e-12 Identities = 36/58 (62%), Positives = 48/58 (82%), Gaps = 1/58 (1%) Frame = -2 Query: 286 EVTRVRGLMKEQGVKKQPGYSWMEIGGQVHLF-SGGGLHPEIDRIHLELEKINLHMKI 116 EVTR+R LM+E+G+KKQPGYSWME G +VH+F G HP+I +IH EL++I+LHMK+ Sbjct: 543 EVTRLRFLMRERGLKKQPGYSWMETGSEVHMFLVGDTSHPDIAKIHEELQRIDLHMKM 600 >ref|XP_010939694.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Elaeis guineensis] Length = 574 Score = 77.0 bits (188), Expect = 5e-12 Identities = 40/66 (60%), Positives = 48/66 (72%), Gaps = 1/66 (1%) Frame = -2 Query: 286 EVTRVRGLMKEQGVKKQPGYSWMEIGGQVHLF-SGGGLHPEIDRIHLELEKINLHMKINS 110 EVTRVR LMKE+GVKKQPGYSW EIG +VH+F G HP+I +I EL +I LHMK Sbjct: 508 EVTRVRILMKEKGVKKQPGYSWTEIGDRVHVFLVGDASHPDIGQILSELGRICLHMKFLD 567 Query: 109 DIEDLI 92 D D++ Sbjct: 568 DEADIV 573 >gb|KRH43148.1| hypothetical protein GLYMA_08G133500 [Glycine max] Length = 569 Score = 76.6 bits (187), Expect = 7e-12 Identities = 35/67 (52%), Positives = 47/67 (70%), Gaps = 1/67 (1%) Frame = -2 Query: 286 EVTRVRGLMKEQGVKKQPGYSWMEIGGQVHLFSGGG-LHPEIDRIHLELEKINLHMKINS 110 +V R+R LMKEQGVKKQ YSW++IG + H F GG HP I+ IH+ L +I LHMK+ Sbjct: 503 DVHRIRVLMKEQGVKKQTAYSWLQIGNKTHYFVGGDPSHPNINDIHVALRRITLHMKVKG 562 Query: 109 DIEDLIF 89 + E++ F Sbjct: 563 NYEEIFF 569 >gb|KHN29038.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 379 Score = 76.3 bits (186), Expect = 9e-12 Identities = 35/67 (52%), Positives = 47/67 (70%), Gaps = 1/67 (1%) Frame = -2 Query: 286 EVTRVRGLMKEQGVKKQPGYSWMEIGGQVHLFSGGG-LHPEIDRIHLELEKINLHMKINS 110 +V R+R LMKEQGVKKQ YSW++IG + H F GG HP I+ IH+ L +I LHMK+ Sbjct: 313 DVHRIRILMKEQGVKKQTAYSWLQIGNKTHYFVGGDPSHPNINDIHVALRRITLHMKVKG 372 Query: 109 DIEDLIF 89 + E++ F Sbjct: 373 NYEEIFF 379 >ref|XP_012469820.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Gossypium raimondii] Length = 589 Score = 75.9 bits (185), Expect = 1e-11 Identities = 38/65 (58%), Positives = 49/65 (75%), Gaps = 1/65 (1%) Frame = -2 Query: 286 EVTRVRGLMKEQGVKKQPGYSWMEIGGQVHLFSGGGL-HPEIDRIHLELEKINLHMKINS 110 EVTRVR MKEQGVKKQ YSWMEIG +VH F GG + HP+ ++IHLE++ I+L MK Sbjct: 517 EVTRVRLQMKEQGVKKQCAYSWMEIGNKVHHFLGGDISHPDTNKIHLEIKSISLQMKALV 576 Query: 109 DIEDL 95 +I ++ Sbjct: 577 NIAEI 581 >ref|XP_006660222.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Oryza brachyantha] Length = 490 Score = 75.9 bits (185), Expect = 1e-11 Identities = 37/61 (60%), Positives = 46/61 (75%), Gaps = 1/61 (1%) Frame = -2 Query: 286 EVTRVRGLMKEQGVKKQPGYSWMEIGGQVHLFSGG-GLHPEIDRIHLELEKINLHMKINS 110 EV RVRG MKE+GVKKQPG+SW EI +VH+F GG HPE+D I EL KI+ HM++ + Sbjct: 417 EVNRVRGQMKEKGVKKQPGHSWTEIADKVHMFVGGDASHPEMDMILSELRKISFHMQMIT 476 Query: 109 D 107 D Sbjct: 477 D 477 >ref|XP_006353205.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Solanum tuberosum] Length = 592 Score = 75.9 bits (185), Expect = 1e-11 Identities = 36/64 (56%), Positives = 44/64 (68%), Gaps = 1/64 (1%) Frame = -2 Query: 286 EVTRVRGLMKEQGVKKQPGYSWMEIGGQVHLFSGGGL-HPEIDRIHLELEKINLHMKINS 110 EVTRVRGLMKE G++KQP YSW EI +VH F GG + HP I IH L+++NL MK Sbjct: 514 EVTRVRGLMKEHGIRKQPAYSWTEIENKVHYFLGGDISHPRIREIHTTLKQMNLQMKFQE 573 Query: 109 DIED 98 + D Sbjct: 574 KVLD 577 >ref|XP_007047867.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] gi|508700128|gb|EOX92024.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] Length = 620 Score = 75.9 bits (185), Expect = 1e-11 Identities = 38/65 (58%), Positives = 48/65 (73%), Gaps = 1/65 (1%) Frame = -2 Query: 286 EVTRVRGLMKEQGVKKQPGYSWMEIGGQVHLFSGGGL-HPEIDRIHLELEKINLHMKINS 110 EVTRVR MKEQGVKKQ YSWMEIG + H F GG + HP+ D+IHLE++ I+L MK Sbjct: 548 EVTRVRLQMKEQGVKKQCAYSWMEIGSKTHHFLGGDVSHPDTDKIHLEIKSISLQMKALV 607 Query: 109 DIEDL 95 +I ++ Sbjct: 608 NIAEI 612 >gb|KJB18235.1| hypothetical protein B456_003G041200 [Gossypium raimondii] Length = 997 Score = 75.5 bits (184), Expect = 1e-11 Identities = 38/63 (60%), Positives = 48/63 (76%), Gaps = 1/63 (1%) Frame = -2 Query: 286 EVTRVRGLMKEQGVKKQPGYSWMEIGGQVHLFSGGGL-HPEIDRIHLELEKINLHMKINS 110 EVTRVR MKEQGVKKQ YSWMEIG +VH F GG + HP+ ++IHLE++ I+L MK + Sbjct: 448 EVTRVRLQMKEQGVKKQCAYSWMEIGNKVHHFLGGDISHPDTNKIHLEIKSISLQMKALA 507 Query: 109 DIE 101 + E Sbjct: 508 EKE 510