BLASTX nr result
ID: Cinnamomum24_contig00032718
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00032718 (288 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535432.1| conserved hypothetical protein [Ricinus comm... 59 7e-08 >ref|XP_002535432.1| conserved hypothetical protein [Ricinus communis] gi|255597764|ref|XP_002536851.1| conserved hypothetical protein [Ricinus communis] gi|223518343|gb|EEF25532.1| conserved hypothetical protein [Ricinus communis] gi|223523131|gb|EEF26949.1| conserved hypothetical protein [Ricinus communis] Length = 88 Score = 58.9 bits (141), Expect(2) = 7e-08 Identities = 30/38 (78%), Positives = 33/38 (86%), Gaps = 2/38 (5%) Frame = +1 Query: 181 RAPALLAFFTGARRMYHSSRS--*GKESSVCYNHYGNE 288 ++ ALLAFFTGARRMYHSSRS GKESSVCYN YG+E Sbjct: 39 KSSALLAFFTGARRMYHSSRSPRSGKESSVCYNLYGDE 76 Score = 24.3 bits (51), Expect(2) = 7e-08 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +3 Query: 69 GTEDWSAPQSGA 104 GTEDW AP+S A Sbjct: 31 GTEDWFAPKSSA 42