BLASTX nr result
ID: Cinnamomum24_contig00032579
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00032579 (275 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008233202.1| PREDICTED: histone H3-like centromeric prote... 72 2e-10 ref|XP_007219168.1| hypothetical protein PRUPE_ppa016454mg, part... 72 2e-10 ref|XP_004306687.1| PREDICTED: histone H3-like centromeric prote... 70 6e-10 gb|AHW98228.1| centromeric histone 3 [Cajanus cajanifolius] 68 3e-09 ref|XP_010051964.1| PREDICTED: histone H3-like centromeric prote... 67 5e-09 gb|KCW75799.1| hypothetical protein EUGRSUZ_D00189 [Eucalyptus g... 67 5e-09 dbj|BAF49717.1| putative centromeric histone H3-like protein_1 [... 67 5e-09 dbj|BAF49730.1| centromeric histone H3-like protein-1 [Eruca sat... 67 5e-09 gb|AAT96389.1| centromeric histone [Olimarabidopsis pumila] gi|1... 67 5e-09 dbj|BAC79432.1| histone H3 like protein [Turritis glabra] 67 7e-09 ref|XP_010099597.1| Histone H3-like centromeric protein [Morus n... 66 9e-09 gb|ALK04336.1| centromeric histone H3 protein [Diplotaxis cathol... 66 1e-08 dbj|BAC79430.1| histone H3 like protein [Arabidopsis halleri sub... 66 1e-08 dbj|BAC79428.1| histone H3 like protein [Arabidopsis halleri sub... 66 1e-08 ref|NP_563627.1| Histone H3-like centromeric protein HTR12 [Arab... 66 1e-08 ref|XP_010661900.1| PREDICTED: histone H3-like centromeric prote... 66 1e-08 ref|XP_010661899.1| PREDICTED: histone H3-like centromeric prote... 66 1e-08 ref|XP_010326926.1| PREDICTED: histone H3-like centromeric prote... 66 1e-08 ref|XP_002281073.1| PREDICTED: histone H3-like centromeric prote... 66 1e-08 ref|NP_001289496.1| histone H3-like centromeric protein HTR12 [N... 66 1e-08 >ref|XP_008233202.1| PREDICTED: histone H3-like centromeric protein HTR12 [Prunus mume] Length = 172 Score = 72.0 bits (175), Expect = 2e-10 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -1 Query: 275 AEAHLVNLFEDSMLCAIHAKRVTLMRKDFELARRIGGL 162 AE HLV+LFEDSMLCAIHAKRVTLM+KDFELARRIGG+ Sbjct: 131 AEDHLVHLFEDSMLCAIHAKRVTLMKKDFELARRIGGI 168 >ref|XP_007219168.1| hypothetical protein PRUPE_ppa016454mg, partial [Prunus persica] gi|462415630|gb|EMJ20367.1| hypothetical protein PRUPE_ppa016454mg, partial [Prunus persica] Length = 123 Score = 72.0 bits (175), Expect = 2e-10 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -1 Query: 275 AEAHLVNLFEDSMLCAIHAKRVTLMRKDFELARRIGGL 162 AE HLV+LFEDSMLCAIHAKRVTLM+KDFELARRIGG+ Sbjct: 82 AEDHLVHLFEDSMLCAIHAKRVTLMKKDFELARRIGGI 119 >ref|XP_004306687.1| PREDICTED: histone H3-like centromeric protein cnp1 isoform X1 [Fragaria vesca subsp. vesca] Length = 170 Score = 70.1 bits (170), Expect = 6e-10 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = -1 Query: 275 AEAHLVNLFEDSMLCAIHAKRVTLMRKDFELARRIGGL 162 AE +LV+LFEDSMLCAIHAKRVTLMRKDFELARR+GG+ Sbjct: 129 AEDYLVHLFEDSMLCAIHAKRVTLMRKDFELARRLGGI 166 >gb|AHW98228.1| centromeric histone 3 [Cajanus cajanifolius] Length = 157 Score = 67.8 bits (164), Expect = 3e-09 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -1 Query: 275 AEAHLVNLFEDSMLCAIHAKRVTLMRKDFELARRIGGL 162 AE HLV+LFED MLCAIHAKRVTLM+KD ELARR+GG+ Sbjct: 116 AEEHLVHLFEDGMLCAIHAKRVTLMKKDIELARRLGGI 153 >ref|XP_010051964.1| PREDICTED: histone H3-like centromeric protein HTR12 [Eucalyptus grandis] Length = 129 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -1 Query: 275 AEAHLVNLFEDSMLCAIHAKRVTLMRKDFELARRIGG 165 AE LV+LFED+MLCAIHAKRVTLMRKDFELARR+GG Sbjct: 88 AEDFLVHLFEDAMLCAIHAKRVTLMRKDFELARRLGG 124 >gb|KCW75799.1| hypothetical protein EUGRSUZ_D00189 [Eucalyptus grandis] Length = 167 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -1 Query: 275 AEAHLVNLFEDSMLCAIHAKRVTLMRKDFELARRIGG 165 AE LV+LFED+MLCAIHAKRVTLMRKDFELARR+GG Sbjct: 126 AEDFLVHLFEDAMLCAIHAKRVTLMRKDFELARRLGG 162 >dbj|BAF49717.1| putative centromeric histone H3-like protein_1 [Olimarabidopsis pumila] Length = 173 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -1 Query: 275 AEAHLVNLFEDSMLCAIHAKRVTLMRKDFELARRIGG 165 AE +LV LF DSMLCAIHAKRVTLMRKDFELARR+GG Sbjct: 132 AEDYLVGLFSDSMLCAIHAKRVTLMRKDFELARRLGG 168 >dbj|BAF49730.1| centromeric histone H3-like protein-1 [Eruca sativa] Length = 164 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -1 Query: 275 AEAHLVNLFEDSMLCAIHAKRVTLMRKDFELARRIGG 165 AE +LV LF DSMLCAIHAKRVTLMRKDFELARR+GG Sbjct: 123 AEDYLVGLFSDSMLCAIHAKRVTLMRKDFELARRLGG 159 >gb|AAT96389.1| centromeric histone [Olimarabidopsis pumila] gi|134152505|dbj|BAF49718.1| putative centromeric histone H3-like protein_2 [Olimarabidopsis pumila] Length = 174 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -1 Query: 275 AEAHLVNLFEDSMLCAIHAKRVTLMRKDFELARRIGG 165 AE +LV LF DSMLCAIHAKRVTLMRKDFELARR+GG Sbjct: 133 AEDYLVGLFSDSMLCAIHAKRVTLMRKDFELARRLGG 169 >dbj|BAC79432.1| histone H3 like protein [Turritis glabra] Length = 174 Score = 66.6 bits (161), Expect = 7e-09 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -1 Query: 275 AEAHLVNLFEDSMLCAIHAKRVTLMRKDFELARRIGG 165 AE +LV LF DSMLCAIHA+RVTLMRKDFELARRIGG Sbjct: 133 AEDYLVGLFSDSMLCAIHARRVTLMRKDFELARRIGG 169 >ref|XP_010099597.1| Histone H3-like centromeric protein [Morus notabilis] gi|587891361|gb|EXB79991.1| Histone H3-like centromeric protein [Morus notabilis] Length = 129 Score = 66.2 bits (160), Expect = 9e-09 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -1 Query: 275 AEAHLVNLFEDSMLCAIHAKRVTLMRKDFELARRIGG 165 AE LV+LFE+SMLCAIHAKRVTLM+KDFELARRIGG Sbjct: 88 AEDFLVHLFEESMLCAIHAKRVTLMKKDFELARRIGG 124 >gb|ALK04336.1| centromeric histone H3 protein [Diplotaxis catholica] gi|940620520|gb|ALK04341.1| centromeric histone H3 protein [Diplotaxis catholica] Length = 174 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -1 Query: 275 AEAHLVNLFEDSMLCAIHAKRVTLMRKDFELARRIGG 165 AE +LV LF DSMLCAIHA+RVTLMRKDFELARR+GG Sbjct: 133 AEDYLVGLFSDSMLCAIHARRVTLMRKDFELARRLGG 169 >dbj|BAC79430.1| histone H3 like protein [Arabidopsis halleri subsp. gemmifera] Length = 176 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -1 Query: 275 AEAHLVNLFEDSMLCAIHAKRVTLMRKDFELARRIGG 165 AE +LV LF DSMLCAIHA+RVTLMRKDFELARR+GG Sbjct: 135 AEDYLVGLFSDSMLCAIHARRVTLMRKDFELARRLGG 171 >dbj|BAC79428.1| histone H3 like protein [Arabidopsis halleri subsp. gemmifera] gi|33146138|dbj|BAC79429.1| histone H3 like protein [Arabidopsis halleri subsp. gemmifera] Length = 176 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -1 Query: 275 AEAHLVNLFEDSMLCAIHAKRVTLMRKDFELARRIGG 165 AE +LV LF DSMLCAIHA+RVTLMRKDFELARR+GG Sbjct: 135 AEDYLVGLFSDSMLCAIHARRVTLMRKDFELARRLGG 171 >ref|NP_563627.1| Histone H3-like centromeric protein HTR12 [Arabidopsis thaliana] gi|79316243|ref|NP_001030927.1| Histone H3-like centromeric protein HTR12 [Arabidopsis thaliana] gi|75158588|sp|Q8RVQ9.3|HTR12_ARATH RecName: Full=Histone H3-like centromeric protein HTR12; AltName: Full=Centromeric histone CENH3 gi|19338702|gb|AAL86775.1|AF465800_1 centromeric histone H3 HTR12 [Arabidopsis thaliana] gi|33146134|dbj|BAC79427.1| histone H3 like protein [Arabidopsis thaliana] gi|51969822|dbj|BAD43603.1| centromeric histone H3 HTR12 [Arabidopsis thaliana] gi|89001039|gb|ABD59109.1| At1g01370 [Arabidopsis thaliana] gi|148356915|dbj|BAF63141.1| centromeric histone H3-like protein_2 [Arabidopsis suecica] gi|332189157|gb|AEE27278.1| Histone H3-like centromeric protein HTR12 [Arabidopsis thaliana] gi|332189158|gb|AEE27279.1| Histone H3-like centromeric protein HTR12 [Arabidopsis thaliana] Length = 178 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -1 Query: 275 AEAHLVNLFEDSMLCAIHAKRVTLMRKDFELARRIGG 165 AE +LV LF DSMLCAIHA+RVTLMRKDFELARR+GG Sbjct: 137 AEDYLVGLFSDSMLCAIHARRVTLMRKDFELARRLGG 173 >ref|XP_010661900.1| PREDICTED: histone H3-like centromeric protein HTR12 isoform X3 [Vitis vinifera] Length = 155 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/37 (83%), Positives = 36/37 (97%) Frame = -1 Query: 275 AEAHLVNLFEDSMLCAIHAKRVTLMRKDFELARRIGG 165 AE +LV+LFED+MLCAIHAKRVTLM+KD+ELARRIGG Sbjct: 114 AEDYLVHLFEDAMLCAIHAKRVTLMKKDWELARRIGG 150 >ref|XP_010661899.1| PREDICTED: histone H3-like centromeric protein HTR12 isoform X1 [Vitis vinifera] Length = 158 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/37 (83%), Positives = 36/37 (97%) Frame = -1 Query: 275 AEAHLVNLFEDSMLCAIHAKRVTLMRKDFELARRIGG 165 AE +LV+LFED+MLCAIHAKRVTLM+KD+ELARRIGG Sbjct: 117 AEDYLVHLFEDAMLCAIHAKRVTLMKKDWELARRIGG 153 >ref|XP_010326926.1| PREDICTED: histone H3-like centromeric protein HTR12 [Solanum lycopersicum] Length = 144 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -1 Query: 275 AEAHLVNLFEDSMLCAIHAKRVTLMRKDFELARRIGG 165 AE LV+LFED+MLCAIHAKRVTLM+KDFELARR+GG Sbjct: 103 AEDFLVHLFEDAMLCAIHAKRVTLMKKDFELARRLGG 139 >ref|XP_002281073.1| PREDICTED: histone H3-like centromeric protein HTR12 isoform X2 [Vitis vinifera] gi|297745416|emb|CBI40496.3| unnamed protein product [Vitis vinifera] Length = 156 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/37 (83%), Positives = 36/37 (97%) Frame = -1 Query: 275 AEAHLVNLFEDSMLCAIHAKRVTLMRKDFELARRIGG 165 AE +LV+LFED+MLCAIHAKRVTLM+KD+ELARRIGG Sbjct: 115 AEDYLVHLFEDAMLCAIHAKRVTLMKKDWELARRIGG 151 >ref|NP_001289496.1| histone H3-like centromeric protein HTR12 [Nicotiana sylvestris] gi|218744593|dbj|BAH03515.1| centromere specific histone H3 variant [Nicotiana tabacum] gi|218744596|dbj|BAH03516.1| centromere specific histone H3 variant [Nicotiana sylvestris] Length = 157 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -1 Query: 275 AEAHLVNLFEDSMLCAIHAKRVTLMRKDFELARRIGG 165 AE LV+LF+DSMLCAIHAKRVTLM+KDFELARR+GG Sbjct: 116 AEDFLVHLFDDSMLCAIHAKRVTLMKKDFELARRLGG 152