BLASTX nr result
ID: Cinnamomum24_contig00032417
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00032417 (406 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010254654.1| PREDICTED: protein trichome birefringence-li... 61 3e-07 >ref|XP_010254654.1| PREDICTED: protein trichome birefringence-like 12 [Nelumbo nucifera] Length = 417 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/59 (49%), Positives = 36/59 (61%), Gaps = 1/59 (1%) Frame = -2 Query: 222 PLYSPKSPKESKGSFPKPHHHHTSPPCNFSRPLDPRSPSH-PIYNGSCPFHRNAWNCLK 49 P+ S KSP + P+ H SP CN R R PS+ PIY+ +CPFHRNAWNCL+ Sbjct: 39 PMQSLKSPLKESQKNPQLERRHPSPICNLFRGHWVRDPSYRPIYDENCPFHRNAWNCLR 97