BLASTX nr result
ID: Cinnamomum24_contig00032238
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00032238 (362 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006836804.1| PREDICTED: probable serine/threonine-protein... 62 2e-07 >ref|XP_006836804.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 [Amborella trichopoda] gi|548839368|gb|ERM99657.1| hypothetical protein AMTR_s00099p00026630 [Amborella trichopoda] Length = 730 Score = 61.6 bits (148), Expect = 2e-07 Identities = 35/78 (44%), Positives = 45/78 (57%), Gaps = 1/78 (1%) Frame = -2 Query: 235 MGCVCSKGIDTDKYNGTRREKGLRKSS-RRLVAPSRREEVIVXXXXXXXXXXXERLISKS 59 MGC+CSK TD Y R EK KS+ RR PS+REEVIV RLISK Sbjct: 1 MGCICSKASTTDDYIENRTEKNSSKSTARRSSTPSKREEVIVVDDGGTERESRVRLISKP 60 Query: 58 QEIVLPTLASDEGEAKEV 5 + +V+ L+S++GE + V Sbjct: 61 EPVVVTPLSSEDGEKRVV 78