BLASTX nr result
ID: Cinnamomum24_contig00032203
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00032203 (331 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI28813.3| unnamed protein product [Vitis vinifera] 89 1e-15 ref|XP_004975979.1| PREDICTED: pentatricopeptide repeat-containi... 89 1e-15 ref|XP_002448053.1| hypothetical protein SORBIDRAFT_06g020256 [S... 88 3e-15 ref|XP_008812212.1| PREDICTED: pentatricopeptide repeat-containi... 87 5e-15 ref|XP_006483347.1| PREDICTED: pentatricopeptide repeat-containi... 87 6e-15 ref|XP_006483346.1| PREDICTED: pentatricopeptide repeat-containi... 87 6e-15 ref|XP_006450458.1| hypothetical protein CICLE_v10010438mg, part... 87 6e-15 ref|XP_011622603.1| PREDICTED: pentatricopeptide repeat-containi... 86 8e-15 ref|XP_010250083.1| PREDICTED: pentatricopeptide repeat-containi... 86 8e-15 ref|XP_009760808.1| PREDICTED: pentatricopeptide repeat-containi... 86 8e-15 ref|XP_009386684.1| PREDICTED: pentatricopeptide repeat-containi... 86 8e-15 ref|XP_011622405.1| PREDICTED: pentatricopeptide repeat-containi... 86 1e-14 ref|XP_010279274.1| PREDICTED: pentatricopeptide repeat-containi... 86 1e-14 ref|XP_009134331.1| PREDICTED: pentatricopeptide repeat-containi... 86 1e-14 gb|EMT27117.1| hypothetical protein F775_08942 [Aegilops tauschii] 86 1e-14 ref|XP_004244755.1| PREDICTED: pentatricopeptide repeat-containi... 86 1e-14 ref|XP_013601792.1| PREDICTED: pentatricopeptide repeat-containi... 85 2e-14 ref|XP_011624785.1| PREDICTED: pentatricopeptide repeat-containi... 85 2e-14 ref|XP_010923707.1| PREDICTED: pentatricopeptide repeat-containi... 85 2e-14 ref|XP_009371401.1| PREDICTED: pentatricopeptide repeat-containi... 85 2e-14 >emb|CBI28813.3| unnamed protein product [Vitis vinifera] Length = 500 Score = 89.0 bits (219), Expect = 1e-15 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -2 Query: 330 RVCTDCHAATKLLSKIYKREIVVRDRSRFHHFKDGSCSCMDFW 202 RVC DCH+ATKL+SKIY REI+VRDR RFHHF+DGSCSCMDFW Sbjct: 458 RVCADCHSATKLISKIYNREIIVRDRCRFHHFRDGSCSCMDFW 500 >ref|XP_004975979.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Setaria italica] gi|944233383|gb|KQK97745.1| hypothetical protein SETIT_012174mg [Setaria italica] Length = 695 Score = 89.0 bits (219), Expect = 1e-15 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -2 Query: 330 RVCTDCHAATKLLSKIYKREIVVRDRSRFHHFKDGSCSCMDFW 202 RVCTDCH+ATKL+SK+Y REIVVRDR+RFHHFKDGSCSC D+W Sbjct: 653 RVCTDCHSATKLISKVYNREIVVRDRNRFHHFKDGSCSCNDYW 695 >ref|XP_002448053.1| hypothetical protein SORBIDRAFT_06g020256 [Sorghum bicolor] gi|241939236|gb|EES12381.1| hypothetical protein SORBIDRAFT_06g020256 [Sorghum bicolor] Length = 693 Score = 87.8 bits (216), Expect = 3e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = -2 Query: 330 RVCTDCHAATKLLSKIYKREIVVRDRSRFHHFKDGSCSCMDFW 202 RVCTDCH+ATKL+SK+Y REIVVRDR+RFHHFKDG+CSC D+W Sbjct: 651 RVCTDCHSATKLISKVYNREIVVRDRNRFHHFKDGTCSCNDYW 693 >ref|XP_008812212.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Phoenix dactylifera] Length = 695 Score = 87.0 bits (214), Expect = 5e-15 Identities = 34/43 (79%), Positives = 41/43 (95%) Frame = -2 Query: 330 RVCTDCHAATKLLSKIYKREIVVRDRSRFHHFKDGSCSCMDFW 202 RVCTDCH ATK++SK+Y+REIVVRDRSRFHHF+DG+CSC D+W Sbjct: 653 RVCTDCHIATKMISKVYEREIVVRDRSRFHHFRDGNCSCKDYW 695 >ref|XP_006483347.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like isoform X2 [Citrus sinensis] Length = 566 Score = 86.7 bits (213), Expect = 6e-15 Identities = 36/43 (83%), Positives = 38/43 (88%) Frame = -2 Query: 330 RVCTDCHAATKLLSKIYKREIVVRDRSRFHHFKDGSCSCMDFW 202 RVC DCH+ATK +SKIY REIVVRDR RFHHFKDGSCSC DFW Sbjct: 524 RVCNDCHSATKFISKIYNREIVVRDRHRFHHFKDGSCSCRDFW 566 >ref|XP_006483346.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like isoform X1 [Citrus sinensis] Length = 600 Score = 86.7 bits (213), Expect = 6e-15 Identities = 36/43 (83%), Positives = 38/43 (88%) Frame = -2 Query: 330 RVCTDCHAATKLLSKIYKREIVVRDRSRFHHFKDGSCSCMDFW 202 RVC DCH+ATK +SKIY REIVVRDR RFHHFKDGSCSC DFW Sbjct: 558 RVCNDCHSATKFISKIYNREIVVRDRHRFHHFKDGSCSCRDFW 600 >ref|XP_006450458.1| hypothetical protein CICLE_v10010438mg, partial [Citrus clementina] gi|557553684|gb|ESR63698.1| hypothetical protein CICLE_v10010438mg, partial [Citrus clementina] Length = 629 Score = 86.7 bits (213), Expect = 6e-15 Identities = 36/43 (83%), Positives = 38/43 (88%) Frame = -2 Query: 330 RVCTDCHAATKLLSKIYKREIVVRDRSRFHHFKDGSCSCMDFW 202 RVC DCH+ATK +SKIY REIVVRDR RFHHFKDGSCSC DFW Sbjct: 587 RVCNDCHSATKFISKIYNREIVVRDRHRFHHFKDGSCSCRDFW 629 >ref|XP_011622603.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like [Amborella trichopoda] Length = 646 Score = 86.3 bits (212), Expect = 8e-15 Identities = 37/43 (86%), Positives = 38/43 (88%) Frame = -2 Query: 330 RVCTDCHAATKLLSKIYKREIVVRDRSRFHHFKDGSCSCMDFW 202 RVC DCH ATKLLSK Y REI+VRDRSRFHHFKDGSCSC DFW Sbjct: 604 RVCEDCHFATKLLSKTYGREIIVRDRSRFHHFKDGSCSCKDFW 646 >ref|XP_010250083.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Nelumbo nucifera] Length = 631 Score = 86.3 bits (212), Expect = 8e-15 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -2 Query: 330 RVCTDCHAATKLLSKIYKREIVVRDRSRFHHFKDGSCSCMDFW 202 RVC DCH+ATK +SK+Y REIVVRDR+RFHHFKDGSCSC DFW Sbjct: 589 RVCGDCHSATKFISKVYNREIVVRDRNRFHHFKDGSCSCKDFW 631 >ref|XP_009760808.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like, partial [Nicotiana sylvestris] Length = 462 Score = 86.3 bits (212), Expect = 8e-15 Identities = 33/43 (76%), Positives = 43/43 (100%) Frame = -2 Query: 330 RVCTDCHAATKLLSKIYKREIVVRDRSRFHHFKDGSCSCMDFW 202 RVC+DCHAATKL+S+IY+REI+VRDRSRFHHF++G+CSC+D+W Sbjct: 420 RVCSDCHAATKLISRIYEREIIVRDRSRFHHFRNGTCSCLDYW 462 >ref|XP_009386684.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Musa acuminata subsp. malaccensis] Length = 584 Score = 86.3 bits (212), Expect = 8e-15 Identities = 35/43 (81%), Positives = 40/43 (93%) Frame = -2 Query: 330 RVCTDCHAATKLLSKIYKREIVVRDRSRFHHFKDGSCSCMDFW 202 R+CTDCH ATKL+SK+YKREIVVRDR+RFHHFK GSCSC D+W Sbjct: 542 RICTDCHLATKLISKVYKREIVVRDRNRFHHFKYGSCSCNDYW 584 >ref|XP_011622405.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Amborella trichopoda] Length = 578 Score = 85.9 bits (211), Expect = 1e-14 Identities = 33/43 (76%), Positives = 42/43 (97%) Frame = -2 Query: 330 RVCTDCHAATKLLSKIYKREIVVRDRSRFHHFKDGSCSCMDFW 202 RVC+DCH ATKL+SK+++REIV+RD++RFHHF+DGSCSCMDFW Sbjct: 536 RVCSDCHFATKLISKVFRREIVMRDKNRFHHFRDGSCSCMDFW 578 >ref|XP_010279274.1| PREDICTED: pentatricopeptide repeat-containing protein At5g43790 [Nelumbo nucifera] Length = 596 Score = 85.9 bits (211), Expect = 1e-14 Identities = 34/43 (79%), Positives = 40/43 (93%) Frame = -2 Query: 330 RVCTDCHAATKLLSKIYKREIVVRDRSRFHHFKDGSCSCMDFW 202 RVC DCHA TKL+SKIY REI+VRDRSRFHHF+DG+CSC+D+W Sbjct: 554 RVCGDCHATTKLISKIYHREIIVRDRSRFHHFRDGACSCLDYW 596 >ref|XP_009134331.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065 [Brassica rapa] Length = 583 Score = 85.9 bits (211), Expect = 1e-14 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -2 Query: 330 RVCTDCHAATKLLSKIYKREIVVRDRSRFHHFKDGSCSCMDFW 202 RVC DCH A KL+SK+Y+REIVVRDRSRFHHFKDGSCSC D+W Sbjct: 541 RVCADCHLAIKLVSKVYEREIVVRDRSRFHHFKDGSCSCQDYW 583 >gb|EMT27117.1| hypothetical protein F775_08942 [Aegilops tauschii] Length = 588 Score = 85.9 bits (211), Expect = 1e-14 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -2 Query: 330 RVCTDCHAATKLLSKIYKREIVVRDRSRFHHFKDGSCSCMDFW 202 RVC DCHAATKL+SK+Y REIVVRDR+RFHHFKDG CSC D+W Sbjct: 546 RVCVDCHAATKLISKVYNREIVVRDRNRFHHFKDGLCSCNDYW 588 >ref|XP_004244755.1| PREDICTED: pentatricopeptide repeat-containing protein At5g43790 [Solanum lycopersicum] Length = 602 Score = 85.5 bits (210), Expect = 1e-14 Identities = 33/43 (76%), Positives = 41/43 (95%) Frame = -2 Query: 330 RVCTDCHAATKLLSKIYKREIVVRDRSRFHHFKDGSCSCMDFW 202 RVC DCH ATKL+S+IY+REI+VRDRSRFHHFK+G+CSC+D+W Sbjct: 560 RVCNDCHTATKLISRIYEREIIVRDRSRFHHFKNGTCSCLDYW 602 >ref|XP_013601792.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065 [Brassica oleracea var. oleracea] gi|923788747|ref|XP_013683738.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065 [Brassica napus] Length = 582 Score = 85.1 bits (209), Expect = 2e-14 Identities = 35/43 (81%), Positives = 38/43 (88%) Frame = -2 Query: 330 RVCTDCHAATKLLSKIYKREIVVRDRSRFHHFKDGSCSCMDFW 202 RVC DCH A KL+SK+Y REIVVRDRSRFHHFKDGSCSC D+W Sbjct: 540 RVCADCHLAIKLVSKVYDREIVVRDRSRFHHFKDGSCSCQDYW 582 >ref|XP_011624785.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Amborella trichopoda] Length = 496 Score = 85.1 bits (209), Expect = 2e-14 Identities = 33/43 (76%), Positives = 40/43 (93%) Frame = -2 Query: 330 RVCTDCHAATKLLSKIYKREIVVRDRSRFHHFKDGSCSCMDFW 202 RVC DCH+ TK++S++YKREIVVRDR+RFHHFKDG CSCMD+W Sbjct: 454 RVCGDCHSVTKMISRVYKREIVVRDRNRFHHFKDGVCSCMDYW 496 >ref|XP_010923707.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065 [Elaeis guineensis] Length = 626 Score = 85.1 bits (209), Expect = 2e-14 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = -2 Query: 330 RVCTDCHAATKLLSKIYKREIVVRDRSRFHHFKDGSCSCMDFW 202 RVC DCH TKL+SK+Y REIVVRDRSRFHHF+DGSCSC D+W Sbjct: 584 RVCADCHLVTKLISKVYNREIVVRDRSRFHHFRDGSCSCKDYW 626 >ref|XP_009371401.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Pyrus x bretschneideri] Length = 718 Score = 85.1 bits (209), Expect = 2e-14 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -2 Query: 330 RVCTDCHAATKLLSKIYKREIVVRDRSRFHHFKDGSCSCMDFW 202 RVC+DCH ATKL+SK+Y REI+VRDRSRFH F+DGSCSC DFW Sbjct: 676 RVCSDCHTATKLISKVYNREIIVRDRSRFHRFRDGSCSCKDFW 718