BLASTX nr result
ID: Cinnamomum24_contig00030780
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00030780 (325 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010248466.1| PREDICTED: pentatricopeptide repeat-containi... 72 2e-10 >ref|XP_010248466.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Nelumbo nucifera] Length = 589 Score = 71.6 bits (174), Expect = 2e-10 Identities = 33/60 (55%), Positives = 45/60 (75%) Frame = +3 Query: 144 HCHSTPQTQHFCNSYTQLLRSHPQTRPIQQIHARIVVEGSSRTSFSATHLVKSYAKAGYL 323 H H+ +++ SYT++L+ H +R ++QIHARI++EGSS SF ATHLVKSYAKAG L Sbjct: 31 HIHAIQESEDPSTSYTRILQCHASSREVEQIHARIIIEGSSWDSFYATHLVKSYAKAGNL 90