BLASTX nr result
ID: Cinnamomum24_contig00030681
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00030681 (471 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006838598.1| PREDICTED: WEB family protein At3g02930, chl... 57 4e-06 >ref|XP_006838598.1| PREDICTED: WEB family protein At3g02930, chloroplastic [Amborella trichopoda] gi|548841104|gb|ERN01167.1| hypothetical protein AMTR_s00002p00223210 [Amborella trichopoda] Length = 831 Score = 57.4 bits (137), Expect = 4e-06 Identities = 36/108 (33%), Positives = 57/108 (52%) Frame = -2 Query: 326 ETHTEFIATMAKECVVEGSEMQQQLGQANEDVRAANDHVKDSQKENSRVLEEIEEMNKAA 147 + T I T K V +GSE+QQQL Q ED++ + + + E S+ L+ Sbjct: 60 DRRTPKITTPEKRVVSKGSELQQQLNQVQEDLKKVREQLVAVELEKSKALD--------- 110 Query: 146 NDQVIVEIEEMKKAAADANLGPNEALLAQIQVNESCKIEKVCVKDLEQ 3 E++E KK+A +A+ +EAL+AQ + ES +IEK ++EQ Sbjct: 111 ------ELKEAKKSAEEAHSRLSEALVAQKRAEESSEIEKFRADEMEQ 152