BLASTX nr result
ID: Cinnamomum24_contig00030584
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00030584 (222 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008796405.1| PREDICTED: uncharacterized protein LOC103711... 69 3e-22 ref|XP_010243619.1| PREDICTED: multiple C2 and transmembrane dom... 70 4e-22 ref|XP_004290007.1| PREDICTED: multiple C2 and transmembrane dom... 71 5e-22 ref|XP_010936078.1| PREDICTED: multiple C2 and transmembrane dom... 69 5e-22 ref|XP_009798416.1| PREDICTED: multiple C2 and transmembrane dom... 70 3e-21 ref|XP_012085187.1| PREDICTED: multiple C2 and transmembrane dom... 68 4e-21 ref|XP_009591465.1| PREDICTED: multiple C2 and transmembrane dom... 67 4e-21 ref|XP_009775267.1| PREDICTED: multiple C2 and transmembrane dom... 67 4e-21 ref|XP_009596255.1| PREDICTED: multiple C2 and transmembrane dom... 70 4e-21 ref|XP_009386410.1| PREDICTED: multiple C2 and transmembrane dom... 69 4e-21 gb|KDP26441.1| hypothetical protein JCGZ_17599 [Jatropha curcas] 68 4e-21 ref|XP_009372259.1| PREDICTED: multiple C2 and transmembrane dom... 67 6e-21 ref|XP_002533623.1| conserved hypothetical protein [Ricinus comm... 68 6e-21 ref|XP_012083417.1| PREDICTED: multiple C2 and transmembrane dom... 65 7e-21 ref|XP_012830547.1| PREDICTED: protein QUIRKY [Erythranthe gutta... 68 7e-21 ref|XP_006653047.1| PREDICTED: uncharacterized protein LOC102701... 68 7e-21 ref|XP_010483147.1| PREDICTED: uncharacterized protein LOC104761... 73 7e-21 ref|XP_009392304.1| PREDICTED: uncharacterized protein LOC103978... 71 7e-21 ref|XP_002268191.1| PREDICTED: multiple C2 and transmembrane dom... 66 1e-20 emb|CAN83208.1| hypothetical protein VITISV_009141 [Vitis vinifera] 66 1e-20 >ref|XP_008796405.1| PREDICTED: uncharacterized protein LOC103711871 [Phoenix dactylifera] Length = 989 Score = 69.3 bits (168), Expect(2) = 3e-22 Identities = 31/46 (67%), Positives = 40/46 (86%) Frame = -2 Query: 140 ALQGRIQTVVGDLATQGERVQALLSWQDPQMMFLIMVFCLIAAIRF 3 ++ GR+QTVVGD+A+QGERVQALLSW+DP+ FL M+FCL+AA F Sbjct: 899 SVAGRVQTVVGDMASQGERVQALLSWRDPRATFLFMLFCLMAAAVF 944 Score = 62.4 bits (150), Expect(2) = 3e-22 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 222 DELDEEFDAFPTTRSGEIVRMRYDRLRSVAG 130 DELDEEFD FPT+RSGEIVRMRYDRLRSVAG Sbjct: 872 DELDEEFDTFPTSRSGEIVRMRYDRLRSVAG 902 >ref|XP_010243619.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 1 [Nelumbo nucifera] Length = 1014 Score = 70.5 bits (171), Expect(2) = 4e-22 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -2 Query: 140 ALQGRIQTVVGDLATQGERVQALLSWQDPQMMFLIMVFCLIAAIRF 3 ++ GRIQTVVGDLATQGER QALLSW+DP+ FL +V CLIAA+ F Sbjct: 924 SVAGRIQTVVGDLATQGERFQALLSWRDPRATFLFVVLCLIAAVGF 969 Score = 60.8 bits (146), Expect(2) = 4e-22 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 222 DELDEEFDAFPTTRSGEIVRMRYDRLRSVAG 130 DELDEEFD FPTTRS E+VRMRYDRLRSVAG Sbjct: 897 DELDEEFDTFPTTRSAELVRMRYDRLRSVAG 927 >ref|XP_004290007.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 1 [Fragaria vesca subsp. vesca] Length = 1022 Score = 70.9 bits (172), Expect(2) = 5e-22 Identities = 32/46 (69%), Positives = 40/46 (86%) Frame = -2 Query: 140 ALQGRIQTVVGDLATQGERVQALLSWQDPQMMFLIMVFCLIAAIRF 3 ++ GRIQTVVGD+ATQGER QALLSW+DP+ FL ++FCLIAA+ F Sbjct: 932 SVAGRIQTVVGDVATQGERFQALLSWRDPRATFLFVIFCLIAAVVF 977 Score = 60.1 bits (144), Expect(2) = 5e-22 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 222 DELDEEFDAFPTTRSGEIVRMRYDRLRSVAG 130 DELDEEFD+FPT+RS E+VRMRYDRLRSVAG Sbjct: 905 DELDEEFDSFPTSRSAEVVRMRYDRLRSVAG 935 >ref|XP_010936078.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 2 [Elaeis guineensis] Length = 990 Score = 69.3 bits (168), Expect(2) = 5e-22 Identities = 31/46 (67%), Positives = 40/46 (86%) Frame = -2 Query: 140 ALQGRIQTVVGDLATQGERVQALLSWQDPQMMFLIMVFCLIAAIRF 3 ++ GR+QTVVGD+A+QGERVQALLSW+DP+ FL M+FCL+AA F Sbjct: 900 SVAGRVQTVVGDMASQGERVQALLSWRDPRATFLFMLFCLMAAAVF 945 Score = 61.6 bits (148), Expect(2) = 5e-22 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 222 DELDEEFDAFPTTRSGEIVRMRYDRLRSVAG 130 DELDEEFD FPT+RSGE+VRMRYDRLRSVAG Sbjct: 873 DELDEEFDTFPTSRSGELVRMRYDRLRSVAG 903 >ref|XP_009798416.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 1-like [Nicotiana sylvestris] Length = 1009 Score = 70.1 bits (170), Expect(2) = 3e-21 Identities = 31/44 (70%), Positives = 39/44 (88%) Frame = -2 Query: 140 ALQGRIQTVVGDLATQGERVQALLSWQDPQMMFLIMVFCLIAAI 9 +L GRIQTVVGD+ATQGER+QALLSW+DP+ L ++FCL+AAI Sbjct: 919 SLAGRIQTVVGDMATQGERIQALLSWRDPRATILFIIFCLLAAI 962 Score = 58.2 bits (139), Expect(2) = 3e-21 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -1 Query: 222 DELDEEFDAFPTTRSGEIVRMRYDRLRSVAG 130 DELDEEFD FPT+RS E+VRMRYDRLRS+AG Sbjct: 892 DELDEEFDTFPTSRSSELVRMRYDRLRSLAG 922 >ref|XP_012085187.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 1 [Jatropha curcas] Length = 1020 Score = 68.2 bits (165), Expect(2) = 4e-21 Identities = 31/46 (67%), Positives = 38/46 (82%) Frame = -2 Query: 140 ALQGRIQTVVGDLATQGERVQALLSWQDPQMMFLIMVFCLIAAIRF 3 ++ GRIQTVVGD+ATQGER QALLSW+DP+ FL +V CL AA+ F Sbjct: 930 SVAGRIQTVVGDMATQGERFQALLSWRDPRASFLFVVMCLFAAVGF 975 Score = 59.7 bits (143), Expect(2) = 4e-21 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 222 DELDEEFDAFPTTRSGEIVRMRYDRLRSVAG 130 DELDEEFD+FPT+RS E+VRMRYDRLRSVAG Sbjct: 903 DELDEEFDSFPTSRSAELVRMRYDRLRSVAG 933 >ref|XP_009591465.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 1 [Nicotiana tomentosiformis] Length = 1012 Score = 67.4 bits (163), Expect(2) = 4e-21 Identities = 30/46 (65%), Positives = 37/46 (80%) Frame = -2 Query: 140 ALQGRIQTVVGDLATQGERVQALLSWQDPQMMFLIMVFCLIAAIRF 3 ++ GRIQTVVGD+ATQGER QALLSW+DP+ FL ++FC AA F Sbjct: 922 SVAGRIQTVVGDMATQGERFQALLSWRDPRATFLFVIFCFFAAFGF 967 Score = 60.5 bits (145), Expect(2) = 4e-21 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 222 DELDEEFDAFPTTRSGEIVRMRYDRLRSVAG 130 DELDEEFD+FPT+RS EIVRMRYDRLRSVAG Sbjct: 895 DELDEEFDSFPTSRSAEIVRMRYDRLRSVAG 925 >ref|XP_009775267.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 1 [Nicotiana sylvestris] Length = 1010 Score = 67.4 bits (163), Expect(2) = 4e-21 Identities = 30/46 (65%), Positives = 37/46 (80%) Frame = -2 Query: 140 ALQGRIQTVVGDLATQGERVQALLSWQDPQMMFLIMVFCLIAAIRF 3 ++ GRIQTVVGD+ATQGER QALLSW+DP+ FL ++FC AA F Sbjct: 920 SVAGRIQTVVGDMATQGERFQALLSWRDPRATFLFVIFCFFAAFGF 965 Score = 60.5 bits (145), Expect(2) = 4e-21 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 222 DELDEEFDAFPTTRSGEIVRMRYDRLRSVAG 130 DELDEEFD+FPT+RS EIVRMRYDRLRSVAG Sbjct: 893 DELDEEFDSFPTSRSAEIVRMRYDRLRSVAG 923 >ref|XP_009596255.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 2-like [Nicotiana tomentosiformis] gi|697174649|ref|XP_009596256.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 2-like [Nicotiana tomentosiformis] gi|697174651|ref|XP_009596257.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 2-like [Nicotiana tomentosiformis] Length = 1009 Score = 69.7 bits (169), Expect(2) = 4e-21 Identities = 31/44 (70%), Positives = 39/44 (88%) Frame = -2 Query: 140 ALQGRIQTVVGDLATQGERVQALLSWQDPQMMFLIMVFCLIAAI 9 +L GRIQTVVGD+ATQGER+QALLSW+DP+ L ++FCL+AAI Sbjct: 919 SLAGRIQTVVGDVATQGERIQALLSWRDPRATILFIIFCLLAAI 962 Score = 58.2 bits (139), Expect(2) = 4e-21 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -1 Query: 222 DELDEEFDAFPTTRSGEIVRMRYDRLRSVAG 130 DELDEEFD FPT+RS E+VRMRYDRLRS+AG Sbjct: 892 DELDEEFDTFPTSRSSELVRMRYDRLRSLAG 922 >ref|XP_009386410.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 1-like [Musa acuminata subsp. malaccensis] gi|695078072|ref|XP_009386411.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 1-like [Musa acuminata subsp. malaccensis] gi|695078074|ref|XP_009386412.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 1-like [Musa acuminata subsp. malaccensis] gi|695078076|ref|XP_009386413.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 1-like [Musa acuminata subsp. malaccensis] gi|695078078|ref|XP_009386414.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 1-like [Musa acuminata subsp. malaccensis] gi|695078080|ref|XP_009386415.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 1-like [Musa acuminata subsp. malaccensis] Length = 1004 Score = 68.6 bits (166), Expect(2) = 4e-21 Identities = 31/44 (70%), Positives = 39/44 (88%) Frame = -2 Query: 140 ALQGRIQTVVGDLATQGERVQALLSWQDPQMMFLIMVFCLIAAI 9 ++ GRIQTVVGDLATQGERVQALLSW+DP+ + +VFCL+AA+ Sbjct: 914 SVAGRIQTVVGDLATQGERVQALLSWRDPRATAIFVVFCLVAAL 957 Score = 59.3 bits (142), Expect(2) = 4e-21 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 222 DELDEEFDAFPTTRSGEIVRMRYDRLRSVAG 130 DELDEEFD FPT+RS E+VRMRYDRLRSVAG Sbjct: 887 DELDEEFDTFPTSRSAELVRMRYDRLRSVAG 917 >gb|KDP26441.1| hypothetical protein JCGZ_17599 [Jatropha curcas] Length = 680 Score = 68.2 bits (165), Expect(2) = 4e-21 Identities = 31/46 (67%), Positives = 38/46 (82%) Frame = -2 Query: 140 ALQGRIQTVVGDLATQGERVQALLSWQDPQMMFLIMVFCLIAAIRF 3 ++ GRIQTVVGD+ATQGER QALLSW+DP+ FL +V CL AA+ F Sbjct: 590 SVAGRIQTVVGDMATQGERFQALLSWRDPRASFLFVVMCLFAAVGF 635 Score = 59.7 bits (143), Expect(2) = 4e-21 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 222 DELDEEFDAFPTTRSGEIVRMRYDRLRSVAG 130 DELDEEFD+FPT+RS E+VRMRYDRLRSVAG Sbjct: 563 DELDEEFDSFPTSRSAELVRMRYDRLRSVAG 593 >ref|XP_009372259.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 1 [Pyrus x bretschneideri] Length = 1027 Score = 67.4 bits (163), Expect(2) = 6e-21 Identities = 30/42 (71%), Positives = 37/42 (88%) Frame = -2 Query: 140 ALQGRIQTVVGDLATQGERVQALLSWQDPQMMFLIMVFCLIA 15 ++ GRIQTVVGD+ATQGER QALLSW+DP+ FL ++FCLIA Sbjct: 937 SVAGRIQTVVGDMATQGERFQALLSWRDPRATFLFVIFCLIA 978 Score = 60.1 bits (144), Expect(2) = 6e-21 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 222 DELDEEFDAFPTTRSGEIVRMRYDRLRSVAG 130 DELDEEFD+FPT+RS E+VRMRYDRLRSVAG Sbjct: 910 DELDEEFDSFPTSRSAEVVRMRYDRLRSVAG 940 >ref|XP_002533623.1| conserved hypothetical protein [Ricinus communis] gi|223526481|gb|EEF28752.1| conserved hypothetical protein [Ricinus communis] Length = 892 Score = 68.2 bits (165), Expect(2) = 6e-21 Identities = 30/44 (68%), Positives = 38/44 (86%) Frame = -2 Query: 140 ALQGRIQTVVGDLATQGERVQALLSWQDPQMMFLIMVFCLIAAI 9 ++ GRIQTVVGD+ATQGERVQALLSW+DP+ FL ++ CL AA+ Sbjct: 802 SVAGRIQTVVGDMATQGERVQALLSWRDPRATFLFVIMCLFAAV 845 Score = 59.3 bits (142), Expect(2) = 6e-21 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 222 DELDEEFDAFPTTRSGEIVRMRYDRLRSVAG 130 DELDEEFD+FPT+RS E+VRMRYDRLRSVAG Sbjct: 775 DELDEEFDSFPTSRSAEMVRMRYDRLRSVAG 805 >ref|XP_012083417.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 1-like [Jatropha curcas] gi|643717020|gb|KDP28646.1| hypothetical protein JCGZ_14417 [Jatropha curcas] Length = 1025 Score = 65.5 bits (158), Expect(2) = 7e-21 Identities = 28/44 (63%), Positives = 38/44 (86%) Frame = -2 Query: 140 ALQGRIQTVVGDLATQGERVQALLSWQDPQMMFLIMVFCLIAAI 9 ++ GRIQTVVGD+ATQGER+Q+LLSW+DP+ + + FCL+AAI Sbjct: 935 SVAGRIQTVVGDMATQGERIQSLLSWRDPRATAIFVTFCLVAAI 978 Score = 61.6 bits (148), Expect(2) = 7e-21 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -1 Query: 222 DELDEEFDAFPTTRSGEIVRMRYDRLRSVAG 130 DELDEEFD FPTTRS EIVRMRYDRLRSVAG Sbjct: 908 DELDEEFDTFPTTRSAEIVRMRYDRLRSVAG 938 >ref|XP_012830547.1| PREDICTED: protein QUIRKY [Erythranthe guttatus] gi|604348221|gb|EYU46376.1| hypothetical protein MIMGU_mgv1a022974mg [Erythranthe guttata] Length = 1018 Score = 68.2 bits (165), Expect(2) = 7e-21 Identities = 31/46 (67%), Positives = 38/46 (82%) Frame = -2 Query: 140 ALQGRIQTVVGDLATQGERVQALLSWQDPQMMFLIMVFCLIAAIRF 3 ++ GRIQTVVGD+ATQGER QALLSW+DP+ FL ++ CLIAA F Sbjct: 928 SVAGRIQTVVGDMATQGERFQALLSWRDPRATFLFVILCLIAAFGF 973 Score = 58.9 bits (141), Expect(2) = 7e-21 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 222 DELDEEFDAFPTTRSGEIVRMRYDRLRSVAG 130 DELDEEFD+FPT R+ EIVRMRYDRLRSVAG Sbjct: 901 DELDEEFDSFPTNRTAEIVRMRYDRLRSVAG 931 >ref|XP_006653047.1| PREDICTED: uncharacterized protein LOC102701166 [Oryza brachyantha] Length = 1009 Score = 67.8 bits (164), Expect(2) = 7e-21 Identities = 31/44 (70%), Positives = 39/44 (88%) Frame = -2 Query: 140 ALQGRIQTVVGDLATQGERVQALLSWQDPQMMFLIMVFCLIAAI 9 ++ GRIQTVVGD+ATQGERVQALLSW+DP+ + ++FCLIAAI Sbjct: 919 SVAGRIQTVVGDIATQGERVQALLSWRDPRATAIFVLFCLIAAI 962 Score = 59.3 bits (142), Expect(2) = 7e-21 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 222 DELDEEFDAFPTTRSGEIVRMRYDRLRSVAG 130 DELDEEFD FPT+RS EIVRMRYDRLRSVAG Sbjct: 892 DELDEEFDTFPTSRSPEIVRMRYDRLRSVAG 922 >ref|XP_010483147.1| PREDICTED: uncharacterized protein LOC104761729 [Camelina sativa] Length = 1005 Score = 72.8 bits (177), Expect(2) = 7e-21 Identities = 32/46 (69%), Positives = 41/46 (89%) Frame = -2 Query: 140 ALQGRIQTVVGDLATQGERVQALLSWQDPQMMFLIMVFCLIAAIRF 3 ++ GR+QTVVGD+A+QGERVQALLSW+DP+ FL +VFCLIAA+ F Sbjct: 915 SIAGRVQTVVGDMASQGERVQALLSWRDPRATFLFLVFCLIAAVGF 960 Score = 54.3 bits (129), Expect(2) = 7e-21 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -1 Query: 222 DELDEEFDAFPTTRSGEIVRMRYDRLRSVAG 130 DELDEEFD FPT+R ++VRMRYDR+RS+AG Sbjct: 888 DELDEEFDTFPTSRGFDVVRMRYDRVRSIAG 918 >ref|XP_009392304.1| PREDICTED: uncharacterized protein LOC103978289 [Musa acuminata subsp. malaccensis] Length = 980 Score = 71.2 bits (173), Expect(2) = 7e-21 Identities = 31/43 (72%), Positives = 39/43 (90%) Frame = -2 Query: 131 GRIQTVVGDLATQGERVQALLSWQDPQMMFLIMVFCLIAAIRF 3 GR+QTVVGD+ATQGERVQALLSW+DP+ FL ++FCL+AA+ F Sbjct: 893 GRVQTVVGDMATQGERVQALLSWRDPRATFLFLMFCLMAAVLF 935 Score = 55.8 bits (133), Expect(2) = 7e-21 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -1 Query: 222 DELDEEFDAFPTTRSGEIVRMRYDRLRSVAG 130 DELDEEFD FPT+R E+VRMRYDRLRSV G Sbjct: 863 DELDEEFDTFPTSRGPEVVRMRYDRLRSVGG 893 >ref|XP_002268191.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 2 [Vitis vinifera] Length = 1012 Score = 66.2 bits (160), Expect(2) = 1e-20 Identities = 30/46 (65%), Positives = 38/46 (82%) Frame = -2 Query: 140 ALQGRIQTVVGDLATQGERVQALLSWQDPQMMFLIMVFCLIAAIRF 3 ++ GRIQTVVGD+A+QGER QALLSW+DP+ FL + FCL AA+ F Sbjct: 922 SVAGRIQTVVGDMASQGERFQALLSWRDPRATFLFVNFCLFAAVGF 967 Score = 60.5 bits (145), Expect(2) = 1e-20 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 222 DELDEEFDAFPTTRSGEIVRMRYDRLRSVAG 130 DELDEEFD+FPT+RS EIVRMRYDRLRSVAG Sbjct: 895 DELDEEFDSFPTSRSAEIVRMRYDRLRSVAG 925 >emb|CAN83208.1| hypothetical protein VITISV_009141 [Vitis vinifera] Length = 1012 Score = 66.2 bits (160), Expect(2) = 1e-20 Identities = 30/46 (65%), Positives = 38/46 (82%) Frame = -2 Query: 140 ALQGRIQTVVGDLATQGERVQALLSWQDPQMMFLIMVFCLIAAIRF 3 ++ GRIQTVVGD+A+QGER QALLSW+DP+ FL + FCL AA+ F Sbjct: 922 SVAGRIQTVVGDMASQGERFQALLSWRDPRATFLFVNFCLFAAVGF 967 Score = 60.5 bits (145), Expect(2) = 1e-20 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 222 DELDEEFDAFPTTRSGEIVRMRYDRLRSVAG 130 DELDEEFD+FPT+RS EIVRMRYDRLRSVAG Sbjct: 895 DELDEEFDSFPTSRSAEIVRMRYDRLRSVAG 925