BLASTX nr result
ID: Cinnamomum24_contig00030336
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00030336 (273 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010088127.1| hypothetical protein L484_013571 [Morus nota... 81 3e-13 ref|XP_010272376.1| PREDICTED: pentatricopeptide repeat-containi... 80 6e-13 ref|XP_004502039.1| PREDICTED: pentatricopeptide repeat-containi... 74 6e-11 ref|XP_004306129.1| PREDICTED: pentatricopeptide repeat-containi... 72 2e-10 ref|XP_003551744.1| PREDICTED: pentatricopeptide repeat-containi... 72 2e-10 ref|XP_008379384.1| PREDICTED: pentatricopeptide repeat-containi... 71 3e-10 ref|XP_014497479.1| PREDICTED: pentatricopeptide repeat-containi... 71 4e-10 gb|KOM36833.1| hypothetical protein LR48_Vigan03g021400 [Vigna a... 71 4e-10 ref|XP_007217215.1| hypothetical protein PRUPE_ppa004696mg [Prun... 70 6e-10 ref|XP_003601393.1| PPR containing plant-like protein [Medicago ... 70 8e-10 ref|XP_008230801.1| PREDICTED: pentatricopeptide repeat-containi... 69 2e-09 ref|XP_012084737.1| PREDICTED: pentatricopeptide repeat-containi... 68 2e-09 ref|XP_002530005.1| pentatricopeptide repeat-containing protein,... 68 3e-09 ref|XP_002323875.2| hypothetical protein POPTR_0017s12280g [Popu... 67 7e-09 ref|XP_010029319.1| PREDICTED: pentatricopeptide repeat-containi... 66 1e-08 ref|XP_007139542.1| hypothetical protein PHAVU_008G038800g [Phas... 66 1e-08 emb|CAN60969.1| hypothetical protein VITISV_033859 [Vitis vinifera] 65 3e-08 ref|XP_010661087.1| PREDICTED: pentatricopeptide repeat-containi... 61 3e-07 gb|KOM51284.1| hypothetical protein LR48_Vigan08g211100 [Vigna a... 60 5e-07 ref|XP_011659892.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 >ref|XP_010088127.1| hypothetical protein L484_013571 [Morus notabilis] gi|587841332|gb|EXB31939.1| hypothetical protein L484_013571 [Morus notabilis] Length = 119 Score = 81.3 bits (199), Expect = 3e-13 Identities = 41/75 (54%), Positives = 46/75 (61%) Frame = -3 Query: 226 NLVSHLLSLSQRCTSMRELKTIHGRXXXXXXXXXXXXXXXXLRFAAVSPSGDLHYAHTLF 47 NLV+ L S+++ C SMR+LK IH RFAAVSPSGDLHYAH LF Sbjct: 10 NLVAALASMAESCLSMRDLKQIHAHAIVANLHRHHVVLGKIFRFAAVSPSGDLHYAHQLF 69 Query: 46 SNTPHPDTFFYNTLI 2 S P P TFFYNTLI Sbjct: 70 SQMPQPRTFFYNTLI 84 >ref|XP_010272376.1| PREDICTED: pentatricopeptide repeat-containing protein At5g56310-like [Nelumbo nucifera] Length = 499 Score = 80.1 bits (196), Expect = 6e-13 Identities = 41/75 (54%), Positives = 50/75 (66%) Frame = -3 Query: 226 NLVSHLLSLSQRCTSMRELKTIHGRXXXXXXXXXXXXXXXXLRFAAVSPSGDLHYAHTLF 47 +L + L S+++ CTSMR+LK IHGR LRFAAVSPSGDLHYA +F Sbjct: 14 SLSTTLASMAESCTSMRDLKRIHGRTIRMGLHLHTLILAKMLRFAAVSPSGDLHYALRIF 73 Query: 46 SNTPHPDTFFYNTLI 2 S+ P P+TFFYNTLI Sbjct: 74 SHMPQPNTFFYNTLI 88 >ref|XP_004502039.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74630-like [Cicer arietinum] Length = 486 Score = 73.6 bits (179), Expect = 6e-11 Identities = 36/75 (48%), Positives = 42/75 (56%) Frame = -3 Query: 226 NLVSHLLSLSQRCTSMRELKTIHGRXXXXXXXXXXXXXXXXLRFAAVSPSGDLHYAHTLF 47 N+ S L+ +++RCTSMR LK IH RF AVSP GDL YAH +F Sbjct: 5 NVASTLVYMAERCTSMRYLKLIHAHAYRTCLHQHTVVLGKLFRFVAVSPFGDLSYAHNMF 64 Query: 46 SNTPHPDTFFYNTLI 2 PHP TFFYN LI Sbjct: 65 DQMPHPSTFFYNILI 79 >ref|XP_004306129.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74630-like [Fragaria vesca subsp. vesca] Length = 487 Score = 72.0 bits (175), Expect = 2e-10 Identities = 38/75 (50%), Positives = 43/75 (57%) Frame = -3 Query: 226 NLVSHLLSLSQRCTSMRELKTIHGRXXXXXXXXXXXXXXXXLRFAAVSPSGDLHYAHTLF 47 +L S L S++Q C SMR+LK IH R RFAAVSPSGDL+YAH LF Sbjct: 8 SLSSRLASMAQTCLSMRQLKQIHARAILSNLHNHAVVLGKMFRFAAVSPSGDLNYAHQLF 67 Query: 46 SNTPHPDTFFYNTLI 2 P TFFYN LI Sbjct: 68 DQMLQPTTFFYNLLI 82 >ref|XP_003551744.1| PREDICTED: pentatricopeptide repeat-containing protein At5g06540-like [Glycine max] gi|947051690|gb|KRH01219.1| hypothetical protein GLYMA_18G262200 [Glycine max] Length = 488 Score = 72.0 bits (175), Expect = 2e-10 Identities = 34/70 (48%), Positives = 40/70 (57%) Frame = -3 Query: 211 LLSLSQRCTSMRELKTIHGRXXXXXXXXXXXXXXXXLRFAAVSPSGDLHYAHTLFSNTPH 32 L +++RCT MR+LK +H RFAAVSP GDL YAH +F PH Sbjct: 10 LAHMAERCTCMRDLKLLHAHAFRTRLHDHTVVLGKLFRFAAVSPLGDLRYAHRMFDQMPH 69 Query: 31 PDTFFYNTLI 2 P TFFYNTLI Sbjct: 70 PTTFFYNTLI 79 >ref|XP_008379384.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like [Malus domestica] Length = 495 Score = 71.2 bits (173), Expect = 3e-10 Identities = 35/70 (50%), Positives = 40/70 (57%) Frame = -3 Query: 211 LLSLSQRCTSMRELKTIHGRXXXXXXXXXXXXXXXXLRFAAVSPSGDLHYAHTLFSNTPH 32 L ++Q C SM LK IHGR RFAA+SP+GDL YAH LF P Sbjct: 17 LAYMAQNCLSMTHLKQIHGRAVVTDLHHHAIVLAKMFRFAAISPAGDLSYAHRLFDQMPR 76 Query: 31 PDTFFYNTLI 2 P+TFFYNTLI Sbjct: 77 PNTFFYNTLI 86 >ref|XP_014497479.1| PREDICTED: pentatricopeptide repeat-containing protein At5g06540-like [Vigna radiata var. radiata] Length = 488 Score = 70.9 bits (172), Expect = 4e-10 Identities = 35/74 (47%), Positives = 42/74 (56%) Frame = -3 Query: 223 LVSHLLSLSQRCTSMRELKTIHGRXXXXXXXXXXXXXXXXLRFAAVSPSGDLHYAHTLFS 44 + S L+ ++QRCT MR+LK +H RFAAVSP GDL YAH +F Sbjct: 6 VASTLVQMAQRCTCMRDLKLLHAHAFRTHLDDHVVVLGKLFRFAAVSPLGDLRYAHLMFD 65 Query: 43 NTPHPDTFFYNTLI 2 PH TFFYNTLI Sbjct: 66 IMPHRTTFFYNTLI 79 >gb|KOM36833.1| hypothetical protein LR48_Vigan03g021400 [Vigna angularis] Length = 488 Score = 70.9 bits (172), Expect = 4e-10 Identities = 35/74 (47%), Positives = 42/74 (56%) Frame = -3 Query: 223 LVSHLLSLSQRCTSMRELKTIHGRXXXXXXXXXXXXXXXXLRFAAVSPSGDLHYAHTLFS 44 + S L+ ++QRCT MR+LK +H RFAAVSP GDL YAH +F Sbjct: 6 VASTLVQMAQRCTCMRDLKLLHAHAFRTHLDDHVVVLGKLFRFAAVSPLGDLRYAHRMFD 65 Query: 43 NTPHPDTFFYNTLI 2 PH TFFYNTLI Sbjct: 66 IMPHRTTFFYNTLI 79 >ref|XP_007217215.1| hypothetical protein PRUPE_ppa004696mg [Prunus persica] gi|462413365|gb|EMJ18414.1| hypothetical protein PRUPE_ppa004696mg [Prunus persica] Length = 495 Score = 70.1 bits (170), Expect = 6e-10 Identities = 35/67 (52%), Positives = 39/67 (58%) Frame = -3 Query: 202 LSQRCTSMRELKTIHGRXXXXXXXXXXXXXXXXLRFAAVSPSGDLHYAHTLFSNTPHPDT 23 ++Q C SMR LK IH R RFAAVSPSGDL+YAH LF + P P T Sbjct: 20 MAQNCLSMRHLKQIHARSIVTNLHHHAIVFAKLFRFAAVSPSGDLNYAHRLFCHMPQPTT 79 Query: 22 FFYNTLI 2 F YNTLI Sbjct: 80 FLYNTLI 86 >ref|XP_003601393.1| PPR containing plant-like protein [Medicago truncatula] gi|355490441|gb|AES71644.1| PPR containing plant-like protein [Medicago truncatula] Length = 486 Score = 69.7 bits (169), Expect = 8e-10 Identities = 34/75 (45%), Positives = 41/75 (54%) Frame = -3 Query: 226 NLVSHLLSLSQRCTSMRELKTIHGRXXXXXXXXXXXXXXXXLRFAAVSPSGDLHYAHTLF 47 N+ S L+ ++++C SMR K IH RFAAVSP GDL YAH +F Sbjct: 5 NVASALVYMAEKCISMRNFKLIHAHAFRTCLHQHAVVLGKLFRFAAVSPFGDLSYAHNMF 64 Query: 46 SNTPHPDTFFYNTLI 2 P P TFFYNTLI Sbjct: 65 DQMPQPTTFFYNTLI 79 >ref|XP_008230801.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74630-like [Prunus mume] Length = 495 Score = 68.6 bits (166), Expect = 2e-09 Identities = 34/67 (50%), Positives = 38/67 (56%) Frame = -3 Query: 202 LSQRCTSMRELKTIHGRXXXXXXXXXXXXXXXXLRFAAVSPSGDLHYAHTLFSNTPHPDT 23 ++Q C SMR LK IH R RFAAVSPSGDL+YAH LF P P T Sbjct: 20 MAQNCLSMRHLKQIHARSIVTNLHHHAIVFAKLFRFAAVSPSGDLNYAHRLFCQMPQPTT 79 Query: 22 FFYNTLI 2 F YNTL+ Sbjct: 80 FLYNTLM 86 >ref|XP_012084737.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Jatropha curcas] Length = 499 Score = 68.2 bits (165), Expect = 2e-09 Identities = 35/74 (47%), Positives = 41/74 (55%) Frame = -3 Query: 223 LVSHLLSLSQRCTSMRELKTIHGRXXXXXXXXXXXXXXXXLRFAAVSPSGDLHYAHTLFS 44 L + L S+++ C SM LK IH LRFAAVSPSGDL YAH +F Sbjct: 15 LAATLASMAETCQSMNHLKQIHAHVILTNLHNNPIIFGKMLRFAAVSPSGDLPYAHRMFD 74 Query: 43 NTPHPDTFFYNTLI 2 P P TFFYNT+I Sbjct: 75 QMPQPKTFFYNTII 88 >ref|XP_002530005.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223530484|gb|EEF32367.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 499 Score = 67.8 bits (164), Expect = 3e-09 Identities = 36/74 (48%), Positives = 41/74 (55%) Frame = -3 Query: 223 LVSHLLSLSQRCTSMRELKTIHGRXXXXXXXXXXXXXXXXLRFAAVSPSGDLHYAHTLFS 44 L S L S+++ C SM LK IH LRFAAVSPSGDL YA LF Sbjct: 15 LASILASIAENCQSMNHLKQIHAHSLLTDLHNHSVILGKMLRFAAVSPSGDLPYAQRLFD 74 Query: 43 NTPHPDTFFYNTLI 2 P P+TFFYNT+I Sbjct: 75 QMPQPNTFFYNTII 88 >ref|XP_002323875.2| hypothetical protein POPTR_0017s12280g [Populus trichocarpa] gi|550320112|gb|EEF04008.2| hypothetical protein POPTR_0017s12280g [Populus trichocarpa] Length = 474 Score = 66.6 bits (161), Expect = 7e-09 Identities = 34/67 (50%), Positives = 38/67 (56%) Frame = -3 Query: 202 LSQRCTSMRELKTIHGRXXXXXXXXXXXXXXXXLRFAAVSPSGDLHYAHTLFSNTPHPDT 23 +++ C SM LK IH LRFAAVSPSGDL YA LF PHP+T Sbjct: 1 MAEACNSMSRLKQIHAHSLLAGLHDHSIILAKMLRFAAVSPSGDLAYAQRLFDQLPHPNT 60 Query: 22 FFYNTLI 2 FFYNTLI Sbjct: 61 FFYNTLI 67 >ref|XP_010029319.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300 [Eucalyptus grandis] gi|629089968|gb|KCW56221.1| hypothetical protein EUGRSUZ_I01971 [Eucalyptus grandis] Length = 496 Score = 65.9 bits (159), Expect = 1e-08 Identities = 36/74 (48%), Positives = 39/74 (52%) Frame = -3 Query: 223 LVSHLLSLSQRCTSMRELKTIHGRXXXXXXXXXXXXXXXXLRFAAVSPSGDLHYAHTLFS 44 L S L SL+ C SMR L IH R RFAAVSPSGDL YAH LF Sbjct: 20 LASALASLADTCLSMRGLTQIHARALRSHLHDHPLVLAKIFRFAAVSPSGDLLYAHRLFD 79 Query: 43 NTPHPDTFFYNTLI 2 P P+ FF+N LI Sbjct: 80 QIPRPNAFFHNLLI 93 >ref|XP_007139542.1| hypothetical protein PHAVU_008G038800g [Phaseolus vulgaris] gi|561012675|gb|ESW11536.1| hypothetical protein PHAVU_008G038800g [Phaseolus vulgaris] Length = 488 Score = 65.9 bits (159), Expect = 1e-08 Identities = 33/70 (47%), Positives = 38/70 (54%) Frame = -3 Query: 211 LLSLSQRCTSMRELKTIHGRXXXXXXXXXXXXXXXXLRFAAVSPSGDLHYAHTLFSNTPH 32 L ++QRCT M +LK +H RFAAVSP GDL YAH +F PH Sbjct: 10 LAHMAQRCTCMPDLKILHAHAFRMHLHDHVVVLGKLFRFAAVSPMGDLRYAHHMFDIMPH 69 Query: 31 PDTFFYNTLI 2 TFFYNTLI Sbjct: 70 RTTFFYNTLI 79 >emb|CAN60969.1| hypothetical protein VITISV_033859 [Vitis vinifera] Length = 722 Score = 64.7 bits (156), Expect = 3e-08 Identities = 37/86 (43%), Positives = 46/86 (53%), Gaps = 7/86 (8%) Frame = -3 Query: 238 SHDPNLVSHLL-------SLSQRCTSMRELKTIHGRXXXXXXXXXXXXXXXXLRFAAVSP 80 S+ N V H+L S+++ C +M+ LK IH R RFAAVSP Sbjct: 74 SYISNKVMHMLPTSQSLASMAEACLAMQALKLIHARAFRANLHNHALVLAKIFRFAAVSP 133 Query: 79 SGDLHYAHTLFSNTPHPDTFFYNTLI 2 +G LHYA LFS P+TFFYNTLI Sbjct: 134 NGCLHYADRLFSQIHQPNTFFYNTLI 159 Score = 64.7 bits (156), Expect = 3e-08 Identities = 37/86 (43%), Positives = 46/86 (53%), Gaps = 7/86 (8%) Frame = -3 Query: 238 SHDPNLVSHLL-------SLSQRCTSMRELKTIHGRXXXXXXXXXXXXXXXXLRFAAVSP 80 S+ N V H+L S+++ C +M+ LK IH R RFAAVSP Sbjct: 228 SYISNKVMHMLPTSQSLASMAEACLAMQALKLIHARAFRANLHNHALVLAKIFRFAAVSP 287 Query: 79 SGDLHYAHTLFSNTPHPDTFFYNTLI 2 +G LHYA LFS P+TFFYNTLI Sbjct: 288 NGCLHYADRLFSQIHQPNTFFYNTLI 313 >ref|XP_010661087.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74630-like [Vitis vinifera] Length = 488 Score = 61.2 bits (147), Expect = 3e-07 Identities = 32/70 (45%), Positives = 39/70 (55%) Frame = -3 Query: 211 LLSLSQRCTSMRELKTIHGRXXXXXXXXXXXXXXXXLRFAAVSPSGDLHYAHTLFSNTPH 32 L S+++ C +M+ LK IH RFAAVSP+G LHYA LFS Sbjct: 10 LASMAEACLTMQALKLIHALAFRANLHHHALVLAKIFRFAAVSPNGCLHYADRLFSQIHQ 69 Query: 31 PDTFFYNTLI 2 P+TFFYNTLI Sbjct: 70 PNTFFYNTLI 79 >gb|KOM51284.1| hypothetical protein LR48_Vigan08g211100 [Vigna angularis] Length = 497 Score = 60.5 bits (145), Expect = 5e-07 Identities = 31/71 (43%), Positives = 40/71 (56%) Frame = -3 Query: 214 HLLSLSQRCTSMRELKTIHGRXXXXXXXXXXXXXXXXLRFAAVSPSGDLHYAHTLFSNTP 35 +L+SL ++C+SMRE+K IH L F A+SP DL +AHTLFS P Sbjct: 10 NLVSLLEQCSSMREMKQIHAYAITTSLARFTFISSKLLAFCALSPHADLRHAHTLFSRIP 69 Query: 34 HPDTFFYNTLI 2 P F YNT+I Sbjct: 70 FPTLFHYNTII 80 >ref|XP_011659892.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Cucumis sativus] Length = 619 Score = 59.3 bits (142), Expect = 1e-06 Identities = 32/77 (41%), Positives = 42/77 (54%) Frame = -3 Query: 232 DPNLVSHLLSLSQRCTSMRELKTIHGRXXXXXXXXXXXXXXXXLRFAAVSPSGDLHYAHT 53 +P+ + H LS C+SM ELK H + ++F AVS GDLHYA Sbjct: 20 NPSPIFHSLS---SCSSMSELKQFHSQIIRLGLSTDNNAIGRLIKFCAVSKYGDLHYALL 76 Query: 52 LFSNTPHPDTFFYNTLI 2 LF++ P+PD F YNTLI Sbjct: 77 LFNSIPYPDAFIYNTLI 93