BLASTX nr result
ID: Cinnamomum24_contig00030144
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00030144 (375 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534720.1| conserved hypothetical protein [Ricinus comm... 79 6e-17 emb|CAN65986.1| hypothetical protein VITISV_042143 [Vitis vinifera] 72 2e-10 emb|CDY45523.1| BnaCnng12820D [Brassica napus] 64 4e-08 >ref|XP_002534720.1| conserved hypothetical protein [Ricinus communis] gi|223524693|gb|EEF27662.1| conserved hypothetical protein [Ricinus communis] Length = 77 Score = 78.6 bits (192), Expect(2) = 6e-17 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = -1 Query: 318 MQLRGPLVGPDRWWYHTLLKGTVRDTLASYGSVPRNLDLPF 196 MQLRGPLVGPDRWWYHTLLKGTVRDTLASYGS P + PF Sbjct: 1 MQLRGPLVGPDRWWYHTLLKGTVRDTLASYGSAPESGPPPF 41 Score = 35.4 bits (80), Expect(2) = 6e-17 Identities = 17/20 (85%), Positives = 17/20 (85%), Gaps = 1/20 (5%) Frame = -3 Query: 217 PESGPP-LSFDQRVLEPTCP 161 PESGPP SFDQRVLEPT P Sbjct: 34 PESGPPPFSFDQRVLEPTFP 53 >emb|CAN65986.1| hypothetical protein VITISV_042143 [Vitis vinifera] Length = 138 Score = 72.0 bits (175), Expect = 2e-10 Identities = 44/74 (59%), Positives = 45/74 (60%) Frame = -2 Query: 374 RIGGQPPGESDVHGPGE*GCSSVDRSSGLIGGGITPFSKEPYVTLSRHTAPSPGIWTSPF 195 RIGGQPPGES+VHGPG GGITPFSKEPYVTLSRHTAPS PF Sbjct: 5 RIGGQPPGESNVHGPG---------------GGITPFSKEPYVTLSRHTAPSRN-KDLPF 48 Query: 194 L*PTGPRTNLSSQQ 153 P TN SS Q Sbjct: 49 -----PLTNGSSNQ 57 >emb|CDY45523.1| BnaCnng12820D [Brassica napus] Length = 101 Score = 63.9 bits (154), Expect = 4e-08 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = +1 Query: 289 RPDERSTELHPYSPGPCTSLSPGGWPPIL 375 RPDERSTELHPYSPGPCT PGGWPPIL Sbjct: 3 RPDERSTELHPYSPGPCTLFFPGGWPPIL 31