BLASTX nr result
ID: Cinnamomum24_contig00030096
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00030096 (385 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH49030.1| hypothetical protein GLYMA_07G127400 [Glycine max] 105 1e-20 gb|KHN40350.1| Pentatricopeptide repeat-containing protein [Glyc... 105 1e-20 ref|XP_003530188.2| PREDICTED: pentatricopeptide repeat-containi... 105 1e-20 ref|XP_014506010.1| PREDICTED: pentatricopeptide repeat-containi... 102 9e-20 ref|XP_007152938.1| hypothetical protein PHAVU_004G172900g [Phas... 102 9e-20 gb|KRH74179.1| hypothetical protein GLYMA_01G004400 [Glycine max] 101 2e-19 ref|XP_002280644.1| PREDICTED: pentatricopeptide repeat-containi... 100 3e-19 dbj|BAB01039.1| unnamed protein product [Arabidopsis thaliana] 100 6e-19 ref|NP_188050.1| pentatricopeptide repeat-containing protein [Ar... 100 6e-19 gb|KOM54150.1| hypothetical protein LR48_Vigan10g004200 [Vigna a... 99 1e-18 ref|XP_011629045.1| PREDICTED: pentatricopeptide repeat-containi... 99 2e-18 ref|XP_012075129.1| PREDICTED: pentatricopeptide repeat-containi... 99 2e-18 ref|XP_011038297.1| PREDICTED: pentatricopeptide repeat-containi... 98 2e-18 ref|XP_006372504.1| hypothetical protein POPTR_0017s02260g [Popu... 98 2e-18 ref|XP_006297069.1| hypothetical protein CARUB_v10013070mg [Caps... 98 3e-18 ref|XP_013616932.1| PREDICTED: pentatricopeptide repeat-containi... 97 4e-18 ref|XP_012081470.1| PREDICTED: putative pentatricopeptide repeat... 97 5e-18 ref|XP_011082278.1| PREDICTED: pentatricopeptide repeat-containi... 97 5e-18 ref|XP_010657139.1| PREDICTED: putative pentatricopeptide repeat... 97 6e-18 emb|CBI38188.3| unnamed protein product [Vitis vinifera] 97 6e-18 >gb|KRH49030.1| hypothetical protein GLYMA_07G127400 [Glycine max] Length = 650 Score = 105 bits (263), Expect = 1e-20 Identities = 46/56 (82%), Positives = 50/56 (89%) Frame = -1 Query: 382 TGNGMPIRITKNLRICVDCHSAMKAISKVVRRVIVLRDTNRFHHFADGECSCGDYW 215 TG GMPIRITKNLR+CVDCHS MKA+SKV RR+IVLRDTNRFHHF +G CSC DYW Sbjct: 595 TGAGMPIRITKNLRVCVDCHSWMKAVSKVTRRLIVLRDTNRFHHFENGSCSCKDYW 650 >gb|KHN40350.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 505 Score = 105 bits (263), Expect = 1e-20 Identities = 46/56 (82%), Positives = 50/56 (89%) Frame = -1 Query: 382 TGNGMPIRITKNLRICVDCHSAMKAISKVVRRVIVLRDTNRFHHFADGECSCGDYW 215 TG GMPIRITKNLR+CVDCHS MKA+SKV RR+IVLRDTNRFHHF +G CSC DYW Sbjct: 450 TGAGMPIRITKNLRVCVDCHSWMKAVSKVTRRLIVLRDTNRFHHFENGSCSCKDYW 505 >ref|XP_003530188.2| PREDICTED: pentatricopeptide repeat-containing protein At3g14330-like [Glycine max] Length = 706 Score = 105 bits (263), Expect = 1e-20 Identities = 46/56 (82%), Positives = 50/56 (89%) Frame = -1 Query: 382 TGNGMPIRITKNLRICVDCHSAMKAISKVVRRVIVLRDTNRFHHFADGECSCGDYW 215 TG GMPIRITKNLR+CVDCHS MKA+SKV RR+IVLRDTNRFHHF +G CSC DYW Sbjct: 651 TGAGMPIRITKNLRVCVDCHSWMKAVSKVTRRLIVLRDTNRFHHFENGSCSCKDYW 706 >ref|XP_014506010.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14330 [Vigna radiata var. radiata] Length = 648 Score = 102 bits (255), Expect = 9e-20 Identities = 44/56 (78%), Positives = 50/56 (89%) Frame = -1 Query: 382 TGNGMPIRITKNLRICVDCHSAMKAISKVVRRVIVLRDTNRFHHFADGECSCGDYW 215 TG GMPIRITKNLR+CVDCHS MKA+S+V +R+IVLRDTNRFHHF +G CSC DYW Sbjct: 593 TGAGMPIRITKNLRVCVDCHSWMKAVSEVTKRLIVLRDTNRFHHFENGTCSCKDYW 648 >ref|XP_007152938.1| hypothetical protein PHAVU_004G172900g [Phaseolus vulgaris] gi|561026247|gb|ESW24932.1| hypothetical protein PHAVU_004G172900g [Phaseolus vulgaris] Length = 648 Score = 102 bits (255), Expect = 9e-20 Identities = 44/56 (78%), Positives = 50/56 (89%) Frame = -1 Query: 382 TGNGMPIRITKNLRICVDCHSAMKAISKVVRRVIVLRDTNRFHHFADGECSCGDYW 215 TG GMPIRITKNLR+CVDCHS MKA+S+V RR+IV+RDTNRFHHF +G CSC DYW Sbjct: 593 TGAGMPIRITKNLRVCVDCHSWMKAVSEVTRRLIVVRDTNRFHHFENGTCSCKDYW 648 >gb|KRH74179.1| hypothetical protein GLYMA_01G004400 [Glycine max] Length = 562 Score = 101 bits (252), Expect = 2e-19 Identities = 44/56 (78%), Positives = 49/56 (87%) Frame = -1 Query: 382 TGNGMPIRITKNLRICVDCHSAMKAISKVVRRVIVLRDTNRFHHFADGECSCGDYW 215 T GMPIRITKNLR+CVDCHS MKA+SKV RR+IVLRDTNRFHHF +G CSC D+W Sbjct: 507 TAAGMPIRITKNLRVCVDCHSWMKAVSKVTRRLIVLRDTNRFHHFENGSCSCKDHW 562 >ref|XP_002280644.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14330 [Vitis vinifera] gi|296088358|emb|CBI36803.3| unnamed protein product [Vitis vinifera] Length = 652 Score = 100 bits (250), Expect = 3e-19 Identities = 44/56 (78%), Positives = 48/56 (85%) Frame = -1 Query: 382 TGNGMPIRITKNLRICVDCHSAMKAISKVVRRVIVLRDTNRFHHFADGECSCGDYW 215 T +GMPIRITKNLR+CVDCHS +K +SKV RVIVLRDTNRFHHF DG CSC DYW Sbjct: 597 TASGMPIRITKNLRVCVDCHSWVKTLSKVTGRVIVLRDTNRFHHFKDGVCSCKDYW 652 >dbj|BAB01039.1| unnamed protein product [Arabidopsis thaliana] Length = 717 Score = 100 bits (248), Expect = 6e-19 Identities = 43/56 (76%), Positives = 47/56 (83%) Frame = -1 Query: 382 TGNGMPIRITKNLRICVDCHSAMKAISKVVRRVIVLRDTNRFHHFADGECSCGDYW 215 TG G+PIRITKNLR+C DCHS MK +S+V RRVIVLRDT RFHHF DG CSC DYW Sbjct: 662 TGEGVPIRITKNLRVCADCHSWMKIVSQVTRRVIVLRDTKRFHHFVDGICSCKDYW 717 >ref|NP_188050.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|218546762|sp|Q9LUL5.2|PP229_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g14330 gi|332641981|gb|AEE75502.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 710 Score = 100 bits (248), Expect = 6e-19 Identities = 43/56 (76%), Positives = 47/56 (83%) Frame = -1 Query: 382 TGNGMPIRITKNLRICVDCHSAMKAISKVVRRVIVLRDTNRFHHFADGECSCGDYW 215 TG G+PIRITKNLR+C DCHS MK +S+V RRVIVLRDT RFHHF DG CSC DYW Sbjct: 655 TGEGVPIRITKNLRVCADCHSWMKIVSQVTRRVIVLRDTKRFHHFVDGICSCKDYW 710 >gb|KOM54150.1| hypothetical protein LR48_Vigan10g004200 [Vigna angularis] Length = 648 Score = 99.4 bits (246), Expect = 1e-18 Identities = 43/56 (76%), Positives = 49/56 (87%) Frame = -1 Query: 382 TGNGMPIRITKNLRICVDCHSAMKAISKVVRRVIVLRDTNRFHHFADGECSCGDYW 215 TG GMPIRITKNLR+CVDCHS MKA+S+V R+IVLRDTNRFH+F +G CSC DYW Sbjct: 593 TGPGMPIRITKNLRVCVDCHSWMKAVSEVTMRLIVLRDTNRFHYFENGTCSCKDYW 648 >ref|XP_011629045.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850 [Amborella trichopoda] Length = 696 Score = 98.6 bits (244), Expect = 2e-18 Identities = 41/55 (74%), Positives = 46/55 (83%) Frame = -1 Query: 379 GNGMPIRITKNLRICVDCHSAMKAISKVVRRVIVLRDTNRFHHFADGECSCGDYW 215 G G+PIRITKNLR+C DCHSAMK IS +V R I+LRD NRFHHF +G CSCGDYW Sbjct: 642 GEGIPIRITKNLRVCGDCHSAMKFISSIVEREIILRDNNRFHHFKEGSCSCGDYW 696 >ref|XP_012075129.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14330 [Jatropha curcas] gi|643726736|gb|KDP35384.1| hypothetical protein JCGZ_10368 [Jatropha curcas] Length = 649 Score = 98.6 bits (244), Expect = 2e-18 Identities = 39/56 (69%), Positives = 48/56 (85%) Frame = -1 Query: 382 TGNGMPIRITKNLRICVDCHSAMKAISKVVRRVIVLRDTNRFHHFADGECSCGDYW 215 T +GMPIRITKNLR+C+DCHS +K +S++ R+IVLRDTNRFHHF +G CSC DYW Sbjct: 594 TADGMPIRITKNLRVCIDCHSWVKVVSRITGRIIVLRDTNRFHHFKEGTCSCNDYW 649 >ref|XP_011038297.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14330 [Populus euphratica] Length = 648 Score = 98.2 bits (243), Expect = 2e-18 Identities = 42/56 (75%), Positives = 47/56 (83%) Frame = -1 Query: 382 TGNGMPIRITKNLRICVDCHSAMKAISKVVRRVIVLRDTNRFHHFADGECSCGDYW 215 T GMPIRITKNLR+CVDCHS +K +S+V RVIVLRDTNRFHHF +G CSC DYW Sbjct: 593 TAAGMPIRITKNLRVCVDCHSWIKIVSRVTGRVIVLRDTNRFHHFKEGACSCNDYW 648 >ref|XP_006372504.1| hypothetical protein POPTR_0017s02260g [Populus trichocarpa] gi|550319130|gb|ERP50301.1| hypothetical protein POPTR_0017s02260g [Populus trichocarpa] Length = 648 Score = 98.2 bits (243), Expect = 2e-18 Identities = 42/56 (75%), Positives = 47/56 (83%) Frame = -1 Query: 382 TGNGMPIRITKNLRICVDCHSAMKAISKVVRRVIVLRDTNRFHHFADGECSCGDYW 215 T GMPIRITKNLR+CVDCHS +K +S+V RVIVLRDTNRFHHF +G CSC DYW Sbjct: 593 TAAGMPIRITKNLRVCVDCHSWIKIVSRVTGRVIVLRDTNRFHHFKEGACSCNDYW 648 >ref|XP_006297069.1| hypothetical protein CARUB_v10013070mg [Capsella rubella] gi|482565778|gb|EOA29967.1| hypothetical protein CARUB_v10013070mg [Capsella rubella] Length = 721 Score = 97.8 bits (242), Expect = 3e-18 Identities = 42/56 (75%), Positives = 47/56 (83%) Frame = -1 Query: 382 TGNGMPIRITKNLRICVDCHSAMKAISKVVRRVIVLRDTNRFHHFADGECSCGDYW 215 TG G+PIR+TKNLR+C DCHS MK +S+V RVIVLRDTNRFHHFA G CSC DYW Sbjct: 666 TGQGVPIRVTKNLRVCADCHSWMKIVSEVTGRVIVLRDTNRFHHFAAGICSCKDYW 721 >ref|XP_013616932.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14330-like [Brassica oleracea var. oleracea] Length = 654 Score = 97.4 bits (241), Expect = 4e-18 Identities = 41/56 (73%), Positives = 46/56 (82%) Frame = -1 Query: 382 TGNGMPIRITKNLRICVDCHSAMKAISKVVRRVIVLRDTNRFHHFADGECSCGDYW 215 TG G+PIR+TKNLR+C DCH MK +S+V RVIVLRDT RFHHFADG CSC DYW Sbjct: 599 TGEGVPIRVTKNLRVCADCHEWMKIVSQVTGRVIVLRDTKRFHHFADGVCSCKDYW 654 >ref|XP_012081470.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950 [Jatropha curcas] gi|802669551|ref|XP_012081471.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950 [Jatropha curcas] gi|802669632|ref|XP_012081473.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950 [Jatropha curcas] gi|802669634|ref|XP_012081474.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950 [Jatropha curcas] gi|802669641|ref|XP_012081475.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950 [Jatropha curcas] gi|802669741|ref|XP_012081476.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950 [Jatropha curcas] gi|802669749|ref|XP_012081477.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950 [Jatropha curcas] gi|802669757|ref|XP_012081478.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950 [Jatropha curcas] gi|802669838|ref|XP_012081479.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950 [Jatropha curcas] Length = 1082 Score = 97.1 bits (240), Expect = 5e-18 Identities = 42/54 (77%), Positives = 46/54 (85%) Frame = -1 Query: 376 NGMPIRITKNLRICVDCHSAMKAISKVVRRVIVLRDTNRFHHFADGECSCGDYW 215 +G+PIRI KNLRIC DCHSA K ISKVV R +VLRD+NRFHHF DG CSCGDYW Sbjct: 1029 SGLPIRIMKNLRICGDCHSAFKYISKVVGRQVVLRDSNRFHHFVDGNCSCGDYW 1082 >ref|XP_011082278.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14330 [Sesamum indicum] Length = 649 Score = 97.1 bits (240), Expect = 5e-18 Identities = 40/56 (71%), Positives = 48/56 (85%) Frame = -1 Query: 382 TGNGMPIRITKNLRICVDCHSAMKAISKVVRRVIVLRDTNRFHHFADGECSCGDYW 215 TG+G+PIRITKNLR+C DCH+ MK SKV +R I+LRDTNRFHHF +G+CSC DYW Sbjct: 594 TGSGLPIRITKNLRVCTDCHAWMKHASKVSKRKIILRDTNRFHHFHEGKCSCNDYW 649 >ref|XP_010657139.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Vitis vinifera] gi|731377110|ref|XP_010657142.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Vitis vinifera] gi|731377114|ref|XP_010657146.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Vitis vinifera] gi|731377118|ref|XP_010657152.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Vitis vinifera] gi|731377122|ref|XP_010657154.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Vitis vinifera] gi|731377128|ref|XP_010657159.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Vitis vinifera] gi|731377132|ref|XP_010657164.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Vitis vinifera] gi|731377136|ref|XP_010657166.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Vitis vinifera] Length = 828 Score = 96.7 bits (239), Expect = 6e-18 Identities = 42/57 (73%), Positives = 49/57 (85%) Frame = -1 Query: 385 QTGNGMPIRITKNLRICVDCHSAMKAISKVVRRVIVLRDTNRFHHFADGECSCGDYW 215 +T +G PIRI KNLRICVDCH+A+K ISKVV+R IV+RD NRFHHF +G CSCGDYW Sbjct: 772 RTPSGSPIRIMKNLRICVDCHAAIKCISKVVQREIVVRDINRFHHFQEGLCSCGDYW 828 >emb|CBI38188.3| unnamed protein product [Vitis vinifera] Length = 744 Score = 96.7 bits (239), Expect = 6e-18 Identities = 42/57 (73%), Positives = 49/57 (85%) Frame = -1 Query: 385 QTGNGMPIRITKNLRICVDCHSAMKAISKVVRRVIVLRDTNRFHHFADGECSCGDYW 215 +T +G PIRI KNLRICVDCH+A+K ISKVV+R IV+RD NRFHHF +G CSCGDYW Sbjct: 688 RTPSGSPIRIMKNLRICVDCHAAIKCISKVVQREIVVRDINRFHHFQEGLCSCGDYW 744