BLASTX nr result
ID: Cinnamomum24_contig00029966
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00029966 (397 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011094850.1| PREDICTED: cyclin-dependent protein kinase i... 60 5e-07 >ref|XP_011094850.1| PREDICTED: cyclin-dependent protein kinase inhibitor SMR3-like [Sesamum indicum] Length = 177 Score = 60.5 bits (145), Expect = 5e-07 Identities = 31/75 (41%), Positives = 44/75 (58%) Frame = -2 Query: 315 DRMQEKKLEKMEESFQPKAYQEHGIYKREAQKFQVEEDNDGFGTPRSIKHRIPANRKSPP 136 D +KK E++EE + + + R ++K EED+DGF TP S HRIPA + PP Sbjct: 53 DDDDQKKKEQLEEIKNDEETDKATVSSRGSEKQIAEEDDDGFKTPTSSDHRIPATTQCPP 112 Query: 135 APMKPRRVSMKTKKQ 91 AP KPR + K K++ Sbjct: 113 APKKPRPQTSKLKRK 127