BLASTX nr result
ID: Cinnamomum24_contig00029606
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00029606 (224 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010268475.1| PREDICTED: tubby-like protein 8 [Nelumbo nuc... 61 3e-07 >ref|XP_010268475.1| PREDICTED: tubby-like protein 8 [Nelumbo nucifera] Length = 421 Score = 61.2 bits (147), Expect = 3e-07 Identities = 35/73 (47%), Positives = 45/73 (61%), Gaps = 3/73 (4%) Frame = -1 Query: 215 SGKENATPNHDSSLLKPKPLSERKASPSSLPLLQKRVLKPSSLQLCMQMNEPDSAFGSSL 36 +GKEN+ L K K L + + PS P + R+L+PSSLQLCMQ+NEPD+ FG + Sbjct: 74 NGKENSATEKGGFLNKGKQLLDGRTPPSLGP--KNRILRPSSLQLCMQLNEPDTTFGLKI 131 Query: 35 ---LGDDKSNSLN 6 L DKSNS N Sbjct: 132 WDPLESDKSNSSN 144