BLASTX nr result
ID: Cinnamomum24_contig00029393
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00029393 (351 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008787518.1| PREDICTED: pentatricopeptide repeat-containi... 65 3e-08 ref|XP_010934787.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 ref|XP_006583812.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 ref|XP_006583811.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 >ref|XP_008787518.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Phoenix dactylifera] gi|672128082|ref|XP_008787520.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Phoenix dactylifera] Length = 998 Score = 64.7 bits (156), Expect = 3e-08 Identities = 39/80 (48%), Positives = 52/80 (65%), Gaps = 5/80 (6%) Frame = -2 Query: 227 MRNLRNMQKLTSFKPNSLPFLFRPSSHFSSNHQNPTTNIPSLPFSSPPHCTHQQ-----I 63 M+ L+ ++ L S P+SLP L SS FSS+ + +PSLP S PH TH+ I Sbjct: 1 MKPLKRIKTLASPNPHSLPSL---SSLFSSSPSDQKPLLPSLP-SQNPHQTHESPPQSPI 56 Query: 62 PPSKTNLYSSFFCSLIELYL 3 PPSK++LY+SFFCSLIE Y+ Sbjct: 57 PPSKSHLYASFFCSLIETYI 76 >ref|XP_010934787.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Elaeis guineensis] gi|743831754|ref|XP_010934788.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Elaeis guineensis] gi|743831760|ref|XP_010934789.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Elaeis guineensis] gi|743831764|ref|XP_010934790.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Elaeis guineensis] Length = 998 Score = 58.9 bits (141), Expect = 1e-06 Identities = 36/80 (45%), Positives = 52/80 (65%), Gaps = 5/80 (6%) Frame = -2 Query: 227 MRNLRNMQKLTSFKPNSLPFLFRPSSHFSSNHQNPTTNIPSLPFSSPPHCTHQQ-----I 63 M+ L+ ++ L S P++LP L SS FSS+ + + +PS P S P+ THQ I Sbjct: 1 MKPLKRIKTLASSNPHALPPL---SSFFSSSPPSQKSLLPSHP-SQNPNRTHQSPPQSPI 56 Query: 62 PPSKTNLYSSFFCSLIELYL 3 PPS+++LY+SFFCSLIE Y+ Sbjct: 57 PPSRSHLYASFFCSLIETYV 76 >ref|XP_006583812.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial-like isoform X2 [Glycine max] Length = 867 Score = 58.9 bits (141), Expect = 1e-06 Identities = 35/75 (46%), Positives = 42/75 (56%) Frame = -2 Query: 227 MRNLRNMQKLTSFKPNSLPFLFRPSSHFSSNHQNPTTNIPSLPFSSPPHCTHQQIPPSKT 48 M +L+N+Q T F F+F PS F H NP FSSP H IPP+KT Sbjct: 16 MMHLKNLQSKTLF------FVFSPSRTFHRPHYNPIRR-----FSSPIHKDSILIPPTKT 64 Query: 47 NLYSSFFCSLIELYL 3 LY+SFFC+LI LYL Sbjct: 65 LLYASFFCALIRLYL 79 >ref|XP_006583811.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial-like isoform X1 [Glycine max] gi|947101518|gb|KRH50010.1| hypothetical protein GLYMA_07G194900 [Glycine max] Length = 1037 Score = 58.9 bits (141), Expect = 1e-06 Identities = 35/75 (46%), Positives = 42/75 (56%) Frame = -2 Query: 227 MRNLRNMQKLTSFKPNSLPFLFRPSSHFSSNHQNPTTNIPSLPFSSPPHCTHQQIPPSKT 48 M +L+N+Q T F F+F PS F H NP FSSP H IPP+KT Sbjct: 16 MMHLKNLQSKTLF------FVFSPSRTFHRPHYNPIRR-----FSSPIHKDSILIPPTKT 64 Query: 47 NLYSSFFCSLIELYL 3 LY+SFFC+LI LYL Sbjct: 65 LLYASFFCALIRLYL 79