BLASTX nr result
ID: Cinnamomum24_contig00029371
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00029371 (383 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006833530.2| PREDICTED: 4-hydroxybenzoate polyprenyltrans... 72 2e-10 ref|XP_009401152.1| PREDICTED: 4-hydroxybenzoate polyprenyltrans... 69 1e-09 ref|XP_009375170.1| PREDICTED: 4-hydroxybenzoate polyprenyltrans... 69 1e-09 ref|XP_009369642.1| PREDICTED: 4-hydroxybenzoate polyprenyltrans... 69 1e-09 ref|XP_006484555.1| PREDICTED: 4-hydroxybenzoate polyprenyltrans... 69 1e-09 ref|XP_006437557.1| hypothetical protein CICLE_v10031746mg [Citr... 69 1e-09 gb|KRH00495.1| hypothetical protein GLYMA_18G216400 [Glycine max] 69 2e-09 gb|KRH00494.1| hypothetical protein GLYMA_18G216400 [Glycine max] 69 2e-09 gb|KHN40607.1| 4-hydroxybenzoate polyprenyltransferase, mitochon... 69 2e-09 ref|XP_006602723.1| PREDICTED: 4-hydroxybenzoate polyprenyltrans... 69 2e-09 ref|XP_007140050.1| hypothetical protein PHAVU_008G080300g [Phas... 69 2e-09 ref|XP_011022062.1| PREDICTED: 4-hydroxybenzoate polyprenyltrans... 68 3e-09 ref|XP_010935522.1| PREDICTED: 4-hydroxybenzoate polyprenyltrans... 67 4e-09 ref|XP_002306388.2| hypothetical protein POPTR_0005s09660g [Popu... 67 4e-09 ref|XP_010648357.1| PREDICTED: 4-hydroxybenzoate polyprenyltrans... 67 5e-09 ref|XP_010266704.1| PREDICTED: 4-hydroxybenzoate polyprenyltrans... 67 5e-09 ref|XP_010266703.1| PREDICTED: 4-hydroxybenzoate polyprenyltrans... 67 5e-09 ref|XP_010266699.1| PREDICTED: 4-hydroxybenzoate polyprenyltrans... 67 5e-09 emb|CBI27131.3| unnamed protein product [Vitis vinifera] 67 5e-09 ref|XP_004492586.1| PREDICTED: 4-hydroxybenzoate polyprenyltrans... 67 5e-09 >ref|XP_006833530.2| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial [Amborella trichopoda] Length = 380 Score = 71.6 bits (174), Expect = 2e-10 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -3 Query: 381 WTVDLSNGADCNRKFVSNKWFGAIVFSGILLGRLAS 274 WTVDLS ADCNRKFVSNKWFGAIVFSG+LLGRLAS Sbjct: 345 WTVDLSCRADCNRKFVSNKWFGAIVFSGVLLGRLAS 380 >ref|XP_009401152.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial [Musa acuminata subsp. malaccensis] Length = 397 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -3 Query: 378 TVDLSNGADCNRKFVSNKWFGAIVFSGILLGRLAS 274 TVDLSN ADCNRKFVSNKWFGA+VFSGIL GRLAS Sbjct: 363 TVDLSNRADCNRKFVSNKWFGALVFSGILFGRLAS 397 >ref|XP_009375170.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial-like [Pyrus x bretschneideri] gi|694400136|ref|XP_009375171.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial-like [Pyrus x bretschneideri] gi|694400138|ref|XP_009375172.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial-like [Pyrus x bretschneideri] gi|694406336|ref|XP_009377983.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial-like [Pyrus x bretschneideri] gi|694406339|ref|XP_009377984.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial-like [Pyrus x bretschneideri] Length = 395 Score = 68.9 bits (167), Expect = 1e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -3 Query: 381 WTVDLSNGADCNRKFVSNKWFGAIVFSGILLGRLAS 274 WT DLS+ ADCNRKFVSNKWFGAI+FSGIL GRL+S Sbjct: 360 WTADLSSRADCNRKFVSNKWFGAIIFSGILFGRLSS 395 >ref|XP_009369642.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial-like [Pyrus x bretschneideri] gi|694387816|ref|XP_009369643.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial-like [Pyrus x bretschneideri] Length = 393 Score = 68.9 bits (167), Expect = 1e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -3 Query: 381 WTVDLSNGADCNRKFVSNKWFGAIVFSGILLGRLAS 274 WT DLS+ ADCNRKFVSNKWFGAI+FSGIL GRL+S Sbjct: 358 WTADLSSRADCNRKFVSNKWFGAIIFSGILFGRLSS 393 >ref|XP_006484555.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial-like isoform X1 [Citrus sinensis] Length = 395 Score = 68.9 bits (167), Expect = 1e-09 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -3 Query: 381 WTVDLSNGADCNRKFVSNKWFGAIVFSGILLGRL 280 WTVDLS+ ADCNRKFVSNKWFGAIVFSGIL GRL Sbjct: 360 WTVDLSSRADCNRKFVSNKWFGAIVFSGILFGRL 393 >ref|XP_006437557.1| hypothetical protein CICLE_v10031746mg [Citrus clementina] gi|567890075|ref|XP_006437558.1| hypothetical protein CICLE_v10031746mg [Citrus clementina] gi|557539753|gb|ESR50797.1| hypothetical protein CICLE_v10031746mg [Citrus clementina] gi|557539754|gb|ESR50798.1| hypothetical protein CICLE_v10031746mg [Citrus clementina] Length = 395 Score = 68.9 bits (167), Expect = 1e-09 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -3 Query: 381 WTVDLSNGADCNRKFVSNKWFGAIVFSGILLGRL 280 WTVDLS+ ADCNRKFVSNKWFGAIVFSGIL GRL Sbjct: 360 WTVDLSSRADCNRKFVSNKWFGAIVFSGILFGRL 393 >gb|KRH00495.1| hypothetical protein GLYMA_18G216400 [Glycine max] Length = 223 Score = 68.6 bits (166), Expect = 2e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -3 Query: 381 WTVDLSNGADCNRKFVSNKWFGAIVFSGILLGRLAS 274 WTVDLS+ ADCNRKFVSNKWFGAI+F GIL GRL+S Sbjct: 188 WTVDLSSRADCNRKFVSNKWFGAIIFGGILAGRLSS 223 >gb|KRH00494.1| hypothetical protein GLYMA_18G216400 [Glycine max] Length = 303 Score = 68.6 bits (166), Expect = 2e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -3 Query: 381 WTVDLSNGADCNRKFVSNKWFGAIVFSGILLGRLAS 274 WTVDLS+ ADCNRKFVSNKWFGAI+F GIL GRL+S Sbjct: 268 WTVDLSSRADCNRKFVSNKWFGAIIFGGILAGRLSS 303 >gb|KHN40607.1| 4-hydroxybenzoate polyprenyltransferase, mitochondrial [Glycine soja] Length = 391 Score = 68.6 bits (166), Expect = 2e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -3 Query: 381 WTVDLSNGADCNRKFVSNKWFGAIVFSGILLGRLAS 274 WTVDLS+ ADCNRKFVSNKWFGAI+F GIL GRL+S Sbjct: 356 WTVDLSSRADCNRKFVSNKWFGAIIFGGILAGRLSS 391 >ref|XP_006602723.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial-like isoform X1 [Glycine max] gi|571547925|ref|XP_006602724.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial-like isoform X2 [Glycine max] gi|571547929|ref|XP_006602725.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial-like isoform X3 [Glycine max] gi|571547932|ref|XP_006602726.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial-like isoform X4 [Glycine max] gi|571547934|ref|XP_006602727.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial-like isoform X5 [Glycine max] gi|947050963|gb|KRH00492.1| hypothetical protein GLYMA_18G216400 [Glycine max] gi|947050964|gb|KRH00493.1| hypothetical protein GLYMA_18G216400 [Glycine max] Length = 389 Score = 68.6 bits (166), Expect = 2e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -3 Query: 381 WTVDLSNGADCNRKFVSNKWFGAIVFSGILLGRLAS 274 WTVDLS+ ADCNRKFVSNKWFGAI+F GIL GRL+S Sbjct: 354 WTVDLSSRADCNRKFVSNKWFGAIIFGGILAGRLSS 389 >ref|XP_007140050.1| hypothetical protein PHAVU_008G080300g [Phaseolus vulgaris] gi|593342532|ref|XP_007140051.1| hypothetical protein PHAVU_008G080300g [Phaseolus vulgaris] gi|561013183|gb|ESW12044.1| hypothetical protein PHAVU_008G080300g [Phaseolus vulgaris] gi|561013184|gb|ESW12045.1| hypothetical protein PHAVU_008G080300g [Phaseolus vulgaris] Length = 396 Score = 68.6 bits (166), Expect = 2e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -3 Query: 381 WTVDLSNGADCNRKFVSNKWFGAIVFSGILLGRLAS 274 WTVDLS+ ADCNRKFVSNKWFGAI+F GIL GRL+S Sbjct: 361 WTVDLSSRADCNRKFVSNKWFGAIIFGGILAGRLSS 396 >ref|XP_011022062.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial-like [Populus euphratica] gi|743922280|ref|XP_011005216.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial-like [Populus euphratica] gi|743922282|ref|XP_011005217.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial-like [Populus euphratica] gi|743942414|ref|XP_011015705.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial-like [Populus euphratica] gi|743942416|ref|XP_011015706.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial-like [Populus euphratica] Length = 387 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/36 (88%), Positives = 32/36 (88%) Frame = -3 Query: 381 WTVDLSNGADCNRKFVSNKWFGAIVFSGILLGRLAS 274 WTVDLS ADCNRKFVSNKWFGAIVFSGIL GRL S Sbjct: 352 WTVDLSCRADCNRKFVSNKWFGAIVFSGILFGRLWS 387 >ref|XP_010935522.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial isoform X1 [Elaeis guineensis] Length = 400 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -3 Query: 378 TVDLSNGADCNRKFVSNKWFGAIVFSGILLGRLAS 274 TVDLSN A+CNRKFVSNKWFGA+VFSGIL GRLAS Sbjct: 366 TVDLSNRAECNRKFVSNKWFGALVFSGILFGRLAS 400 >ref|XP_002306388.2| hypothetical protein POPTR_0005s09660g [Populus trichocarpa] gi|550338484|gb|EEE93384.2| hypothetical protein POPTR_0005s09660g [Populus trichocarpa] Length = 387 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -3 Query: 381 WTVDLSNGADCNRKFVSNKWFGAIVFSGILLGRLAS 274 WTVDLS ADCNRKFVSNKWFGA+VFSGIL GRL S Sbjct: 352 WTVDLSCRADCNRKFVSNKWFGAVVFSGILFGRLWS 387 >ref|XP_010648357.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial isoform X1 [Vitis vinifera] gi|731370963|ref|XP_010648361.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial isoform X1 [Vitis vinifera] Length = 413 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -3 Query: 381 WTVDLSNGADCNRKFVSNKWFGAIVFSGILLGRLAS 274 WTVDLS ADCNRKFVSNKWFGAI+F GILLG+L+S Sbjct: 378 WTVDLSCRADCNRKFVSNKWFGAILFGGILLGKLSS 413 >ref|XP_010266704.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial isoform X3 [Nelumbo nucifera] Length = 270 Score = 67.0 bits (162), Expect = 5e-09 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -3 Query: 381 WTVDLSNGADCNRKFVSNKWFGAIVFSGILLGRLAS 274 W VDLSN ADCNRKFVSNKWFGAI+F+GIL G++ S Sbjct: 235 WAVDLSNRADCNRKFVSNKWFGAIIFTGILFGKMTS 270 >ref|XP_010266703.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial isoform X2 [Nelumbo nucifera] Length = 399 Score = 67.0 bits (162), Expect = 5e-09 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -3 Query: 381 WTVDLSNGADCNRKFVSNKWFGAIVFSGILLGRLAS 274 W VDLSN ADCNRKFVSNKWFGAI+F+GIL G++ S Sbjct: 364 WAVDLSNRADCNRKFVSNKWFGAIIFTGILFGKMTS 399 >ref|XP_010266699.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial isoform X1 [Nelumbo nucifera] gi|720034344|ref|XP_010266700.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial isoform X1 [Nelumbo nucifera] gi|720034347|ref|XP_010266701.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial isoform X1 [Nelumbo nucifera] gi|720034351|ref|XP_010266702.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial isoform X1 [Nelumbo nucifera] Length = 409 Score = 67.0 bits (162), Expect = 5e-09 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -3 Query: 381 WTVDLSNGADCNRKFVSNKWFGAIVFSGILLGRLAS 274 W VDLSN ADCNRKFVSNKWFGAI+F+GIL G++ S Sbjct: 374 WAVDLSNRADCNRKFVSNKWFGAIIFTGILFGKMTS 409 >emb|CBI27131.3| unnamed protein product [Vitis vinifera] Length = 371 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -3 Query: 381 WTVDLSNGADCNRKFVSNKWFGAIVFSGILLGRLAS 274 WTVDLS ADCNRKFVSNKWFGAI+F GILLG+L+S Sbjct: 336 WTVDLSCRADCNRKFVSNKWFGAILFGGILLGKLSS 371 >ref|XP_004492586.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial [Cicer arietinum] gi|502104591|ref|XP_004492588.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial [Cicer arietinum] gi|502104594|ref|XP_004492589.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial [Cicer arietinum] gi|828298481|ref|XP_012569031.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial [Cicer arietinum] gi|828298484|ref|XP_012569032.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial [Cicer arietinum] Length = 396 Score = 67.0 bits (162), Expect = 5e-09 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -3 Query: 381 WTVDLSNGADCNRKFVSNKWFGAIVFSGILLGRLAS 274 WTVDLS+ +DCNRKFVSNKWFGAI+F GIL GRL S Sbjct: 361 WTVDLSSRSDCNRKFVSNKWFGAIIFGGILAGRLVS 396