BLASTX nr result
ID: Cinnamomum24_contig00029351
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00029351 (307 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008242241.1| PREDICTED: pentatricopeptide repeat-containi... 94 5e-17 ref|XP_010276672.1| PREDICTED: pentatricopeptide repeat-containi... 92 2e-16 ref|XP_008388776.1| PREDICTED: pentatricopeptide repeat-containi... 89 1e-15 ref|XP_009337222.1| PREDICTED: pentatricopeptide repeat-containi... 87 6e-15 ref|XP_008459827.1| PREDICTED: pentatricopeptide repeat-containi... 87 6e-15 ref|XP_008459803.1| PREDICTED: pentatricopeptide repeat-containi... 87 6e-15 ref|XP_011648579.1| PREDICTED: pentatricopeptide repeat-containi... 84 3e-14 ref|XP_008337852.1| PREDICTED: pentatricopeptide repeat-containi... 84 3e-14 ref|XP_004141071.1| PREDICTED: pentatricopeptide repeat-containi... 84 3e-14 ref|XP_009359734.1| PREDICTED: pentatricopeptide repeat-containi... 83 9e-14 gb|KJB83000.1| hypothetical protein B456_013G224200, partial [Go... 80 6e-13 ref|XP_012462981.1| PREDICTED: pentatricopeptide repeat-containi... 80 6e-13 ref|XP_008786659.1| PREDICTED: pentatricopeptide repeat-containi... 79 2e-12 ref|XP_007133423.1| hypothetical protein PHAVU_011G177400g, part... 78 2e-12 ref|XP_012089183.1| PREDICTED: pentatricopeptide repeat-containi... 78 3e-12 ref|XP_010917211.1| PREDICTED: pentatricopeptide repeat-containi... 77 5e-12 gb|KHN17724.1| Pentatricopeptide repeat-containing protein [Glyc... 76 9e-12 ref|XP_003550612.1| PREDICTED: pentatricopeptide repeat-containi... 76 9e-12 ref|XP_010090159.1| hypothetical protein L484_027391 [Morus nota... 75 1e-11 ref|XP_011046008.1| PREDICTED: pentatricopeptide repeat-containi... 75 2e-11 >ref|XP_008242241.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000 [Prunus mume] Length = 595 Score = 93.6 bits (231), Expect = 5e-17 Identities = 47/103 (45%), Positives = 65/103 (63%), Gaps = 3/103 (2%) Frame = +3 Query: 6 GHLPDGSVVGCLVASYAKAGNFDSAMSLLAQYHDCGGYRXXXXXXXXXXXXMVRDNRVND 185 GH PD S+V LV+SYA+ G ++A LL + H CG R +V+ N+V + Sbjct: 186 GHTPDDSIVELLVSSYAQMGKLNNAEKLLDEVH-CGEVRLSPFVYNNLFNVLVKQNKVEE 244 Query: 186 AICFFRS---SGFRPDTFTFNIIIKGLCRCGEIDRAFRFFEEM 305 A+C FR S RPD++TFNI+I+GLC+ GEID+AF FF +M Sbjct: 245 AVCLFRKHMGSHCRPDSWTFNILIRGLCKIGEIDKAFEFFSDM 287 >ref|XP_010276672.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000 [Nelumbo nucifera] Length = 586 Score = 91.7 bits (226), Expect = 2e-16 Identities = 48/103 (46%), Positives = 63/103 (61%), Gaps = 3/103 (2%) Frame = +3 Query: 6 GHLPDGSVVGCLVASYAKAGNFDSAMSLLAQYHDCGGYRXXXXXXXXXXXXMVRDNRVND 185 GHLPD S++ L++S A+AG D SL++Q G +V+ NRV + Sbjct: 176 GHLPDSSILAFLLSSCARAGKLDITKSLISQVLG-NGIEVNPFVYNNLLEILVKSNRVQE 234 Query: 186 AICFFR---SSGFRPDTFTFNIIIKGLCRCGEIDRAFRFFEEM 305 A+C R SS FRPDT TFNI+IKGLCR GE+DRAF F++M Sbjct: 235 AVCLLREHLSSCFRPDTCTFNIVIKGLCRIGEVDRAFEIFDDM 277 >ref|XP_008388776.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like [Malus domestica] Length = 593 Score = 89.4 bits (220), Expect = 1e-15 Identities = 47/103 (45%), Positives = 60/103 (58%), Gaps = 3/103 (2%) Frame = +3 Query: 6 GHLPDGSVVGCLVASYAKAGNFDSAMSLLAQYHDCGGYRXXXXXXXXXXXXMVRDNRVND 185 GH PD SVV LV+SYA+ G D A L + H CG R +V N+V++ Sbjct: 184 GHTPDDSVVELLVSSYAQMGKLDDAEKFLNEAH-CGEIRLPPFVYNNLFNVLVXQNKVDE 242 Query: 186 AICFFRS---SGFRPDTFTFNIIIKGLCRCGEIDRAFRFFEEM 305 A+C FR S PD +TFNI+I+GLCR GEID+AF F +M Sbjct: 243 AVCLFRKHMGSHXXPDNWTFNILIRGLCRVGEIDKAFELFSDM 285 >ref|XP_009337222.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like [Pyrus x bretschneideri] Length = 597 Score = 86.7 bits (213), Expect = 6e-15 Identities = 46/103 (44%), Positives = 60/103 (58%), Gaps = 3/103 (2%) Frame = +3 Query: 6 GHLPDGSVVGCLVASYAKAGNFDSAMSLLAQYHDCGGYRXXXXXXXXXXXXMVRDNRVND 185 GH PD SVV LV+SYA+ G D A L + H CG R +V+ N+V++ Sbjct: 188 GHTPDDSVVELLVSSYAQIGKLDDAEKFLDEAH-CGEIRLPPFVYNNLFNVLVKQNKVDE 246 Query: 186 AICFFRS---SGFRPDTFTFNIIIKGLCRCGEIDRAFRFFEEM 305 A+ FR S PD +TFNI+I+GLCR GEID+AF F +M Sbjct: 247 AVSLFRKHMGSHCHPDNWTFNILIRGLCRVGEIDKAFELFSDM 289 >ref|XP_008459827.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000 isoform X2 [Cucumis melo] Length = 548 Score = 86.7 bits (213), Expect = 6e-15 Identities = 45/103 (43%), Positives = 63/103 (61%), Gaps = 3/103 (2%) Frame = +3 Query: 6 GHLPDGSVVGCLVASYAKAGNFDSAMSLLAQYHDCGGYRXXXXXXXXXXXXMVRDNRVND 185 G LPD S++ LV+SYA+ G FDSA + L + H C G + +V+ N V++ Sbjct: 139 GILPDSSILELLVSSYARMGKFDSAKNFLNEVH-CYGIKVSPFVYNNLLNMLVKQNLVDE 197 Query: 186 AICFFRSS---GFRPDTFTFNIIIKGLCRCGEIDRAFRFFEEM 305 A+ FR F PD ++FNI+I+GLCR GEID+AF FF+ M Sbjct: 198 AVSLFREHLEPYFVPDVYSFNILIRGLCRIGEIDKAFEFFQNM 240 >ref|XP_008459803.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000 isoform X1 [Cucumis melo] gi|659071437|ref|XP_008459808.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000 isoform X1 [Cucumis melo] gi|659071439|ref|XP_008459817.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000 isoform X1 [Cucumis melo] Length = 588 Score = 86.7 bits (213), Expect = 6e-15 Identities = 45/103 (43%), Positives = 63/103 (61%), Gaps = 3/103 (2%) Frame = +3 Query: 6 GHLPDGSVVGCLVASYAKAGNFDSAMSLLAQYHDCGGYRXXXXXXXXXXXXMVRDNRVND 185 G LPD S++ LV+SYA+ G FDSA + L + H C G + +V+ N V++ Sbjct: 179 GILPDSSILELLVSSYARMGKFDSAKNFLNEVH-CYGIKVSPFVYNNLLNMLVKQNLVDE 237 Query: 186 AICFFRSS---GFRPDTFTFNIIIKGLCRCGEIDRAFRFFEEM 305 A+ FR F PD ++FNI+I+GLCR GEID+AF FF+ M Sbjct: 238 AVSLFREHLEPYFVPDVYSFNILIRGLCRIGEIDKAFEFFQNM 280 >ref|XP_011648579.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000 isoform X1 [Cucumis sativus] gi|778665517|ref|XP_011648580.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000 isoform X1 [Cucumis sativus] Length = 588 Score = 84.3 bits (207), Expect = 3e-14 Identities = 44/103 (42%), Positives = 62/103 (60%), Gaps = 3/103 (2%) Frame = +3 Query: 6 GHLPDGSVVGCLVASYAKAGNFDSAMSLLAQYHDCGGYRXXXXXXXXXXXXMVRDNRVND 185 G LPD S++ LV+SYA+ G DSA + L + H C G + +V+ N V++ Sbjct: 179 GILPDSSILELLVSSYARMGKLDSAKNFLNEVH-CYGIKVSPFVYNNLLNMLVKQNLVDE 237 Query: 186 AICFFRSS---GFRPDTFTFNIIIKGLCRCGEIDRAFRFFEEM 305 A+ FR F PD ++FNI+I+GLCR GEID+AF FF+ M Sbjct: 238 AVLLFREHLEPYFVPDVYSFNILIRGLCRIGEIDKAFEFFQNM 280 >ref|XP_008337852.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000 [Malus domestica] Length = 597 Score = 84.3 bits (207), Expect = 3e-14 Identities = 44/103 (42%), Positives = 60/103 (58%), Gaps = 3/103 (2%) Frame = +3 Query: 6 GHLPDGSVVGCLVASYAKAGNFDSAMSLLAQYHDCGGYRXXXXXXXXXXXXMVRDNRVND 185 GH PD S V LV+SYA+ G D+A L + H C R +V+ N+V++ Sbjct: 188 GHTPDDSAVELLVSSYAQMGKLDNAEKFLGEVH-CDEIRLTPFVYNNLFNVLVKQNKVDE 246 Query: 186 AICFFRS---SGFRPDTFTFNIIIKGLCRCGEIDRAFRFFEEM 305 A+C FR S PD++TFNI+I+GLCR GEI +AF F +M Sbjct: 247 AVCLFRKHMGSHCCPDSWTFNILIRGLCRVGEIGKAFELFSDM 289 >ref|XP_004141071.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000 isoform X2 [Cucumis sativus] gi|778665521|ref|XP_011648581.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000 isoform X2 [Cucumis sativus] Length = 548 Score = 84.3 bits (207), Expect = 3e-14 Identities = 44/103 (42%), Positives = 62/103 (60%), Gaps = 3/103 (2%) Frame = +3 Query: 6 GHLPDGSVVGCLVASYAKAGNFDSAMSLLAQYHDCGGYRXXXXXXXXXXXXMVRDNRVND 185 G LPD S++ LV+SYA+ G DSA + L + H C G + +V+ N V++ Sbjct: 139 GILPDSSILELLVSSYARMGKLDSAKNFLNEVH-CYGIKVSPFVYNNLLNMLVKQNLVDE 197 Query: 186 AICFFRSS---GFRPDTFTFNIIIKGLCRCGEIDRAFRFFEEM 305 A+ FR F PD ++FNI+I+GLCR GEID+AF FF+ M Sbjct: 198 AVLLFREHLEPYFVPDVYSFNILIRGLCRIGEIDKAFEFFQNM 240 >ref|XP_009359734.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like [Pyrus x bretschneideri] Length = 547 Score = 82.8 bits (203), Expect = 9e-14 Identities = 43/103 (41%), Positives = 60/103 (58%), Gaps = 3/103 (2%) Frame = +3 Query: 6 GHLPDGSVVGCLVASYAKAGNFDSAMSLLAQYHDCGGYRXXXXXXXXXXXXMVRDNRVND 185 GH PD S V LV+SYA+ G D+A L + H C R +V+ N+ ++ Sbjct: 138 GHTPDDSAVELLVSSYAQMGKLDNAEKFLDEVH-CDEIRLTPFVYNNLFNVLVQQNKADE 196 Query: 186 AICFFRS---SGFRPDTFTFNIIIKGLCRCGEIDRAFRFFEEM 305 A+ FR S RPD++TFNI+I+GLCR GE+D+AF F +M Sbjct: 197 AVYLFRKHMWSHCRPDSWTFNILIRGLCRVGEVDKAFELFSDM 239 >gb|KJB83000.1| hypothetical protein B456_013G224200, partial [Gossypium raimondii] Length = 533 Score = 80.1 bits (196), Expect = 6e-13 Identities = 38/103 (36%), Positives = 61/103 (59%), Gaps = 3/103 (2%) Frame = +3 Query: 6 GHLPDGSVVGCLVASYAKAGNFDSAMSLLAQYHDCGGYRXXXXXXXXXXXXMVRDNRVND 185 GHLPD +++G +++S+ +AG F A LLA+ MV+ N + + Sbjct: 150 GHLPDSTLLGFMISSFGRAGEFGMARKLLAEVQS-DDVMVTIFAVNNLLNMMVKQNNLEE 208 Query: 186 AICFFRSS---GFRPDTFTFNIIIKGLCRCGEIDRAFRFFEEM 305 A+ ++ + F PDT+TFNI+I+GLCR G++D+AF FF +M Sbjct: 209 AVSLYKENLGLNFNPDTWTFNILIRGLCRVGKVDQAFEFFNDM 251 >ref|XP_012462981.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000 [Gossypium raimondii] gi|823260519|ref|XP_012462982.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000 [Gossypium raimondii] gi|823260521|ref|XP_012462983.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000 [Gossypium raimondii] gi|823260523|ref|XP_012462984.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000 [Gossypium raimondii] gi|763816146|gb|KJB82998.1| hypothetical protein B456_013G224200 [Gossypium raimondii] gi|763816147|gb|KJB82999.1| hypothetical protein B456_013G224200 [Gossypium raimondii] Length = 524 Score = 80.1 bits (196), Expect = 6e-13 Identities = 38/103 (36%), Positives = 61/103 (59%), Gaps = 3/103 (2%) Frame = +3 Query: 6 GHLPDGSVVGCLVASYAKAGNFDSAMSLLAQYHDCGGYRXXXXXXXXXXXXMVRDNRVND 185 GHLPD +++G +++S+ +AG F A LLA+ MV+ N + + Sbjct: 141 GHLPDSTLLGFMISSFGRAGEFGMARKLLAEVQS-DDVMVTIFAVNNLLNMMVKQNNLEE 199 Query: 186 AICFFRSS---GFRPDTFTFNIIIKGLCRCGEIDRAFRFFEEM 305 A+ ++ + F PDT+TFNI+I+GLCR G++D+AF FF +M Sbjct: 200 AVSLYKENLGLNFNPDTWTFNILIRGLCRVGKVDQAFEFFNDM 242 >ref|XP_008786659.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like [Phoenix dactylifera] gi|672199245|ref|XP_008777563.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like [Phoenix dactylifera] Length = 546 Score = 78.6 bits (192), Expect = 2e-12 Identities = 46/104 (44%), Positives = 58/104 (55%), Gaps = 4/104 (3%) Frame = +3 Query: 6 GHLPDGSVVGCLVASYAKAGNFDSAMSLLAQYHDCGGYRXXXXXXXXXXXXMVRDNRVND 185 GH PDG + S+A+AG D+A+ LLA+ + R +V NR D Sbjct: 133 GHSPDGPYLEFFANSFAEAGQLDAALKLLARASEFN-CRVRCYTFNKLMSLLVGRNRAQD 191 Query: 186 AICFFR----SSGFRPDTFTFNIIIKGLCRCGEIDRAFRFFEEM 305 AI FFR S F PDT +FNI+IKGLCR G+ID AF F +EM Sbjct: 192 AIFFFREQLASQFFTPDTCSFNIVIKGLCRLGDIDGAFEFLKEM 235 >ref|XP_007133423.1| hypothetical protein PHAVU_011G177400g, partial [Phaseolus vulgaris] gi|561006423|gb|ESW05417.1| hypothetical protein PHAVU_011G177400g, partial [Phaseolus vulgaris] Length = 456 Score = 78.2 bits (191), Expect = 2e-12 Identities = 40/103 (38%), Positives = 60/103 (58%), Gaps = 3/103 (2%) Frame = +3 Query: 6 GHLPDGSVVGCLVASYAKAGNFDSAMSLLAQYHDCGGYRXXXXXXXXXXXXMVRDNRVND 185 G LPD ++G LV+S+A A FD + LLA+ C G + +++ N+++D Sbjct: 141 GQLPDSGLLGFLVSSFALADRFDVSKELLAEAQ-CNGIQVKVIVYNNFLNILIKHNKLDD 199 Query: 186 AICFFRS---SGFRPDTFTFNIIIKGLCRCGEIDRAFRFFEEM 305 AIC FR + +TFTFNI+++GLC GE+D AFR +M Sbjct: 200 AICLFRELMRTHSSLETFTFNILMRGLCTAGEVDEAFRLLSDM 242 >ref|XP_012089183.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000 [Jatropha curcas] gi|643708689|gb|KDP23605.1| hypothetical protein JCGZ_23438 [Jatropha curcas] Length = 545 Score = 77.8 bits (190), Expect = 3e-12 Identities = 42/103 (40%), Positives = 62/103 (60%), Gaps = 3/103 (2%) Frame = +3 Query: 6 GHLPDGSVVGCLVASYAKAGNFDSAMSLLAQYHDCGGYRXXXXXXXXXXXXMVRDNRVND 185 G+LPD +++ L+ S+ +AG F+ A LLA+ R +VR N+V++ Sbjct: 137 GYLPDSTLLRFLLTSFVQAGKFNLAKKLLAEIQS-QEVRISSFVYNNLLNELVRRNQVHE 195 Query: 186 AICFFR---SSGFRPDTFTFNIIIKGLCRCGEIDRAFRFFEEM 305 A+C F +S DT+TFNI+I+GLCR GE+DRAF FF +M Sbjct: 196 ALCLFEEHLASHSPADTWTFNILIRGLCRVGEVDRAFEFFNDM 238 >ref|XP_010917211.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000 [Elaeis guineensis] Length = 544 Score = 77.0 bits (188), Expect = 5e-12 Identities = 46/104 (44%), Positives = 57/104 (54%), Gaps = 4/104 (3%) Frame = +3 Query: 6 GHLPDGSVVGCLVASYAKAGNFDSAMSLLAQYHDCGGYRXXXXXXXXXXXXMVRDNRVND 185 GH PDG + S+A+AG D+A+ LLA+ + R +V NR D Sbjct: 131 GHSPDGPCLEFFANSFAEAGQLDAALKLLARASEFN-CRVRCYTFNKFMNLLVGRNRAQD 189 Query: 186 AICFFR----SSGFRPDTFTFNIIIKGLCRCGEIDRAFRFFEEM 305 AI FR S F PDT +FNIIIKGLCR G+ D AF FF+EM Sbjct: 190 AIFLFREQLASQFFTPDTCSFNIIIKGLCRLGDTDGAFEFFKEM 233 >gb|KHN17724.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 544 Score = 76.3 bits (186), Expect = 9e-12 Identities = 41/103 (39%), Positives = 58/103 (56%), Gaps = 3/103 (2%) Frame = +3 Query: 6 GHLPDGSVVGCLVASYAKAGNFDSAMSLLAQYHDCGGYRXXXXXXXXXXXXMVRDNRVND 185 G LPD ++G LV+S+A A FD + LLA+ C G + +++ NR++D Sbjct: 138 GQLPDSRLLGFLVSSFALADRFDVSKELLAEAQ-CSGVQVDVIVYNNFLNILIKHNRLDD 196 Query: 186 AICFFRS---SGFRPDTFTFNIIIKGLCRCGEIDRAFRFFEEM 305 AIC FR S D FTFNI+I+GLC G++D AF +M Sbjct: 197 AICLFRELMRSHSCLDAFTFNILIRGLCTAGDVDEAFELLGDM 239 >ref|XP_003550612.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like [Glycine max] gi|947053152|gb|KRH02605.1| hypothetical protein GLYMA_17G049100 [Glycine max] Length = 544 Score = 76.3 bits (186), Expect = 9e-12 Identities = 41/103 (39%), Positives = 58/103 (56%), Gaps = 3/103 (2%) Frame = +3 Query: 6 GHLPDGSVVGCLVASYAKAGNFDSAMSLLAQYHDCGGYRXXXXXXXXXXXXMVRDNRVND 185 G LPD ++G LV+S+A A FD + LLA+ C G + +++ NR++D Sbjct: 138 GQLPDSRLLGFLVSSFALADRFDVSKELLAEAQ-CSGVQVDVIVYNNFLNILIKHNRLDD 196 Query: 186 AICFFRS---SGFRPDTFTFNIIIKGLCRCGEIDRAFRFFEEM 305 AIC FR S D FTFNI+I+GLC G++D AF +M Sbjct: 197 AICLFRELMRSHSCLDAFTFNILIRGLCTAGDVDEAFELLGDM 239 >ref|XP_010090159.1| hypothetical protein L484_027391 [Morus notabilis] gi|587848697|gb|EXB38956.1| hypothetical protein L484_027391 [Morus notabilis] Length = 570 Score = 75.5 bits (184), Expect = 1e-11 Identities = 42/103 (40%), Positives = 55/103 (53%), Gaps = 3/103 (2%) Frame = +3 Query: 6 GHLPDGSVVGCLVASYAKAGNFDSAMSLLAQYHDCGGYRXXXXXXXXXXXXMVRDNRVND 185 GH PD S + LV +AK G DS LL + R +V++N+V + Sbjct: 167 GHSPDNSTIEFLVCVFAKVGKLDSCEKLLEEI------RASKFVYSSLFNVLVKNNKVYE 220 Query: 186 AICFFRS---SGFRPDTFTFNIIIKGLCRCGEIDRAFRFFEEM 305 A+C FR S F PDT+TFNI+I GLC GE+ AF FF +M Sbjct: 221 AVCLFRKQIGSHFVPDTWTFNILIGGLCGVGEVHSAFEFFNDM 263 >ref|XP_011046008.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000 [Populus euphratica] Length = 545 Score = 75.1 bits (183), Expect = 2e-11 Identities = 42/103 (40%), Positives = 59/103 (57%), Gaps = 3/103 (2%) Frame = +3 Query: 6 GHLPDGSVVGCLVASYAKAGNFDSAMSLLAQYHDCGGYRXXXXXXXXXXXXMVRDNRVND 185 GHLPD ++G LV A+A +FD LLA+ R +V+ N+V++ Sbjct: 136 GHLPDSKLLGFLVTWMAQASDFDMVKKLLAEVQG-KEVRINSFVYNNLLSVLVKQNQVHE 194 Query: 186 AICFFRS---SGFRPDTFTFNIIIKGLCRCGEIDRAFRFFEEM 305 AI F+ PDT+TFNI+I+GLCR G +DRAF FF++M Sbjct: 195 AIYLFKEYLVMQSPPDTWTFNILIRGLCRVGGVDRAFEFFKDM 237